!!NA_SEQUENCE 1.0
ID   AB004063   standard; RNA; VRL; 6495 BP.
XX
AC   AB004063;
XX
SV   AB004063.1
XX
DT   07-JUL-2000 (Rel. 64, Created)
DT   07-JUL-2000 (Rel. 64, Last updated, Version 1)
XX
DE   Apple stem grooving virus genes for 241K polyprotein, 36K protein, complete
DE   cds.
XX
KW   .
XX
OS   Apple stem grooving virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Capillovirus.
XX
RN   [1]
RP   1-6495
RA   Yoshikawa N.;
RT   ;
RL   Submitted (20-MAY-1997) to the EMBL/GenBank/DDBJ databases.
RL   Nobuyuki Yoshikawa, Iwate University, Faculty of Agriculture; Ueda 3-18-8,
RL   Morioka, 020 Japan, Morioka, Iwate 020, Japan
RL   (E-mail:yoshikawa@msv.cc.iwate-u.ac.jp, Tel:019-621-6150, Fax:019-621-6177)
XX
RN   [2]
RA   Terauchi H., Magome H., Yoshikawa N., Takahashi T.;
RT   "Nucleotide sequence of the genome of apple stem grooving capillovirus i
RT   solate and construction of an infectious cDNA clone of the genome
RT   containing a c auliflower mosaic virus 35S RNA.";
RL   Ann. Phytopathol. Soc. Jpn. 63:432-436(1997).
XX
DR   SPTREMBL; Q9IR74; Q9IR74.
DR   SPTREMBL; Q9YPI1; Q9YPI1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .6495
FT                   /db_xref="taxon:28347"
FT                   /sequenced_mol="cDNA to genomic RNA"
FT                   /organism="Apple stem grooving virus"
FT                   /isolate="Li-23"
FT   CDS             36. .6353
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IR74"
FT                   /note="contains two consensus sequences associated with
FT                   RNA-dependent RNA polymerase and NTP-binding helicase"
FT                   /gene="ORF1"
FT                   /product="241K polyprotein"
FT                   /protein_id="BAA98054.1"
FT                   /translation="MVFTYRNPLEIAINKLPSKQSDQLLSLTTDEIEKTLEVTNRFFSF
FT                   SITPEDQELLTKHGLTLAPIGFRSHSHPISKMIENHLLYICIPGLLSSFRSVAFFSLRK
FT                   NKVDNFLQMHSVFSHGKIKSLGMYNAIIDGKDKYRYGEVSFTSFRDRVIGLRNQCLTRN
FT                   KFPKVLFLHDEFHFLSPFDMAFLFETIPEIDRVVATTVFPIELLFGDKVSKEPRVYTYK
FT                   VHGSSFSFYPYGVASECYEQNLANSKWPFTCSGIQWANRKIRVTKLQSLFAHHVFSFDR
FT                   GRACNEFNHFNKPSCLLADEMRLLTKRFDSAVINRSTVSSLSTYMACLKTANAASAVAK
FT                   LRQLEKRDLYPDELNFVYSFGEHFKNFGMRDDFDVSVLQWVKDKFCQVMPHFIAASFFE
FT                   PTEFHLNMRKLLNDLATKGIEVPLSVIILDNVNFIETRFHARMFDIAQAIGVNLNSLGR
FT                   RFDHDTESEEYFSENGYVFMPSKLNPDMKWILNSGSLEIDYSRLIKARRFRLRRDFLDL
FT                   ISRGDAPRRQLFLESTSDPKSNPEVHESDATGEAGSSVNDESCQSPKEFCAPMSTEDGQ
FT                   GFEGSIPIDLMNCFEPEEVKCPRRKRKNDCVFRAISAHLGIETQDLLNFLVNEDISEEL
FT                   LDCIDEDKGLSHEMIDEVLITKGLSMVYTSDFREMAVLNRKYGVNGKMYCTIKANHCEL
FT                   SSKECFVRLLKEGGEAQMSNENLNADSMFDLGKFVHNRERAVKLAKSMARGTTGLLSSF
FT                   DPAFCKSMVTLSELFPENFSSTVGLRLGFAGSGKTHKVLQWINYTPSVKRMFISPRRML
FT                   ADEVEVQLKGTACQVHTWETALKKIDGTFMGVFIDEIGLYPPGYLTLLQMCALRKIVKG
FT                   QSERILKGKLSELSKTCLNMRCFGDPLQLRYYSAEDTNLLDKTHELDILTKTIKHKYLL
FT                   QGYRFGQWFQELINMPTRVDDSKFSRKFFADISSVKTEDYGLILVAKREDKGVFAGRIP
FT                   VATVSESQGMTINKRVLICLDQNLFAGGANAAIVAITRSKVGFDFILKGNSLKEVQKMA
FT                   QKTIWQFVIEAKSIPMERIVNMNPGASFYETPLDGGNSSIQDKASDDLFIMPLINLAEE
FT                   EVDPEEVVGDVIQPVEWFKCHIPVFDTDPMLAEIFDKVAAKEKREFQSILGLSNQFLDM
FT                   EKNGCKIDILPFARQNVFPHHQSSDDVTFWAGVQKRIRKSNWRREKTKFEEFESQGKEL
FT                   LQEFISMLPFEFKVNIKDIEDGEKSFLEKRKLKSEKMWANHSERSDIDWKLDHAFLFMK
FT                   SQYCTKEGKMFTEAKAGQTLACFQHIVLFRFGPMLRAIESAFLRSCGDSYYIHSGKNFF
FT                   CLDSFVTRNAHVFDGFSIESDYTAFDSSQDHVILAFEMALLQYLGVSKEFQLDYLRLKL
FT                   TLGCRLGSLAIMRFTGEFCTFLFNTFANMLFTQLKYKIDPRKHRILFAGDDMCSLSSLK
FT                   RRRGERATRLMGSFSLTAVEEVRKFPMFCGWYLSPYGIIKSPKLLWARIKMMSERQLLK
FT                   ECVDNYLFEAIFAYRLGERLYTILKEEDFEYHYLVIRFFVRNSKLLTGLSKSLIFEIGE
FT                   GIGSEWRSSMSTISSRRSSQQTSRLTQSHPQNFTKMQPFSSQMCSIVSKDLSQMSKFPP
FT                   GLGMDWSCQISSCLMTLKSTQSGKRATSTSTCITESFWLESKQCCQTSEVWKEGSLCMT
FT                   EPVLIRKEAIYARICLSLSLTAVTSVLDLNTAYPPQMPTWRRDSDFVWTLTAHSMNRTL
FT                   SCLLLTLVWPTDVLIQLVSWRPRLETQGGPRRLLVAVRHSDLMKKLKWQFWIISLHYFW
FT                   RKVFQMFILKRGCSEVTRLEGHAQFLQKGGQTRNRRKREDLGPSQLELKDSEKMSLEDV
FT                   LQQARRHRVGVYLWKTHIDPAKELLTVPPPEGFKEGESFEGKELYLLLCNHYCKYLFGN
FT                   IAVFGSSDKTQFPAVGFDTPPVHYNLTTTPKEGETEEQKKAREGSSGEKTKIWRIDLSN
FT                   VVPELKTFAATSRQNSLNECTFRKLCEPFADLAREFLHERWSKGLATNIYKKWPKAFEK
FT                   SPWVAFDFATGLKMNRLTPDEKQVIDRMTKRLFRTEGQKGVFEAGSESNLELEG"
FT   CDS             4787. .5749
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9YPI1"
FT                   /note="movement protein"
FT                   /gene="ORF2"
FT                   /product="36K protein"
FT                   /protein_id="BAA98055.1"
FT                   /translation="MAIVNVNHFLKEVESTDLKIDAISSSELYKDATFFKPDVLNCIKR
FT                   FESNVKVSSRSGDGLVLSDFKLLDDTEIDSIRKKSNKYKYLHYGVILVGIKAMLPNFRG
FT                   MEGRVIVYDGACLNPERGHICSYLFKFESDCCYFGLRPEHCLSTTDANLAKRFRFRVDF
FT                   DCPQYEQDTELFALDIGVAYRCVNSARFLETKTGDSGWTSQAISGCEALRFNEEIKMAI
FT                   LDHKSPLFLEEGVPNVHIEKRLFRGDKIRRSRSISAKRGPNSKPQEKRGFRSLSARIER
FT                   FGENEFGRRASTSEAPPGRSVSLEDTYRPGKGTSDGSSP"
XX
SQ   Sequence 6495 BP; 1939 A; 1234 C; 1502 G; 1820 T; 0 other;

AB004063  Length: 6495  December 21, 2001 14:38  Type: N  Check: 5718  ..
       1  aaatttaaca ggcttaattt ccgcgctcta cgtcaatggt tttcacttac
      51  agaaatccgc tagaaattgc aatcaacaaa cttccaagca agcaatctga
     101  tcaattgctt tccttgacca cagacgagat tgaaaagacc ttagaagtga
     151  caaatcgctt cttctctttt tcaatcaccc cagaagatca agaattgttg
     201  accaaacatg gtctaacact tgcgcctatc ggattcagat cacattccca
     251  tccaatatcc aaaatgatag aaaatcatct cttgtacata tgtattcctg
     301  gtcttctatc ttctttcagg tcagttgcct tcttctccct tagaaagaac
     351  aaagttgata atttccttca aatgcattct gtattttcac acggaaaaat
     401  caaatctttg ggaatgtaca atgcaataat tgacgggaag gacaagtata
     451  ggtatggtga ggtctctttc acctctttca gagatagagt gataggtctt
     501  agaaatcaat gcctcacgcg taataaattt ccaaaggtgt tattccttca
     551  tgacgaattc cactttctta gcccctttga tatggctttt ttatttgaaa
     601  caattccaga aatagacaga gttgttgcaa ccacagtatt tccgattgaa
     651  ctgttatttg gggacaaggt ctctaaggag cctagagttt atacctataa
     701  ggttcatgga tcttcctttt cattttaccc ttacggtgta gcctctgaat
     751  gttatgaaca aaatttggca aattcgaaat ggccttttac ctgtagtggc
     801  attcaatggg ccaataggaa gataagggtg accaagttgc agagcttgtt
     851  tgctcaccat gttttttcat ttgacagagg cagggcctgc aatgaattta
     901  accatttcaa taagccaagc tgcctgctcg cagatgaaat gcgtcttttg
     951  acaaaaaggt tcgattctgc agtcatcaat cggagtacag tttcctctct
    1001  cagcacttac atggcttgcc tcaaaactgc aaacgcagct tcagcagttg
    1051  ctaaattgag acagttggag aagagagacc tctatccaga tgagctgaac
    1101  tttgtttact ctttcgggga acatttcaag aattttggga tgagagatga
    1151  ctttgacgtg tcagttctcc aatgggttaa agacaaattt tgtcaagtta
    1201  tgcctcactt cattgctgct agtttctttg agccaacaga gtttcacctc
    1251  aatatgcgaa aattattaaa tgacctggcc actaagggga tagaggttcc
    1301  actatccgtc attatcctag acaatgtcaa ttttattgaa accaggttcc
    1351  atgccaggat gtttgacata gcgcaggcta ttggggttaa cttgaactca
    1401  cttgggcgca gatttgacca cgatactgaa agtgaggaat atttttcaga
    1451  aaatggctat gtcttcatgc cttccaaatt gaatccagac atgaagtgga
    1501  ttctgaactc tggctcttta gagattgact actctagatt gatcaaggcc
    1551  aggagattca gattaaggag agattttctg gatctcatat ctagaggtga
    1601  tgctcccagg aggcaactct tcttagaatc aaccagtgac cccaagtcaa
    1651  atcccgaggt ccacgagagt gatgcaactg gagaggcagg gtcatcagta
    1701  aatgacgaga gctgccagtc gccaaaggag ttttgtgcgc caatgtccac
    1751  agaggacggc caaggtttcg aaggctcaat cccgattgat ttaatgaatt
    1801  gctttgaacc ggaagaagtt aaatgcccaa gaaggaagag gaagaatgat
    1851  tgcgttttta gggccatttc tgcacacttg ggaattgaaa cccaagactt
    1901  gttgaatttc ctcgttaatg aggacatatc tgaagaacta ttggactgca
    1951  ttgatgaaga caaagggctc tcacatgaaa tgattgacga agtattaatc
    2001  acgaaaggtc tatctatggt ttatacttca gacttcagag agatggcagt
    2051  ccttaacaga aaatatggtg tgaatggtaa aatgtactgc accatcaaag
    2101  ccaaccactg tgaattgagc tcaaaagaat gttttgtcag actgttaaag
    2151  gaaggtggag aagctcaaat gtcaaatgaa aacttgaatg ccgactccat
    2201  gtttgacctt gggaaatttg tgcataacag ggagagagcc gttaaattag
    2251  caaaatcaat ggcgagaggt accacaggtc ttttgagttc ctttgatccc
    2301  gccttctgca agagcatggt cactctttca gagttgtttc ctgagaactt
    2351  ttcatctact gttgggctaa gattgggatt tgctggttca ggaaagaccc
    2401  acaaagtgct ccaatggatc aactacacac caagtgtcaa aagaatgttc
    2451  ataagtccaa gaaggatgct agctgatgaa gttgaggtcc agcttaaagg
    2501  gacagcctgt caagtgcaca cttgggagac cgctttgaag aagattgatg
    2551  gaaccttcat gggggttttt attgatgaaa taggtttgta cccacctgga
    2601  tacctcacat tgttacaaat gtgtgcttta agaaagattg tcaaaggaca
    2651  gagtgagagg atcttgaaag gtaaactcag tgaactgtca aaaacttgtc
    2701  tgaacatgag gtgttttggt gacccattac aattgagata ctactctgct
    2751  gaggacacaa atcttctaga caaaacacat gagctcgaca ttttgactaa
    2801  gacaatcaag cacaaatacc ttcttcaggg gtacagattt ggccaatggt
    2851  ttcaagaact cataaacatg ccaaccaggg tggatgactc aaagttctca
    2901  agaaagttct ttgcggacat ctccagtgtc aagactgaag attacgggct
    2951  cattcttgtt gccaaaaggg aggacaaagg tgtttttgct gggaggatcc
    3001  cagtggccac agttagcgag tctcaaggga tgacaataaa caaaagagta
    3051  ttgatatgtc tggatcaaaa cctctttgct ggaggggcca atgctgcgat
    3101  tgttgcaatc acaaggtcga aagttgggtt tgactttatc ctcaagggga
    3151  actcactgaa ggaagtgcag aagatggccc aaaaaaccat ttggcaattc
    3201  gttattgagg ccaaatctat cccaatggag agaatagtca acatgaatcc
    3251  tggagccagc ttctatgaaa ccccgttgga cggtggaaat tcgtctattc
    3301  aagacaaagc ttctgatgat ttgtttataa tgcctttaat aaatttggct
    3351  gaggaagagg ttgacccaga ggaagttgtt ggggacgtga tacagcctgt
    3401  tgaatggttt aaatgccaca tacctgtctt tgatacagat ccaatgctag
    3451  cagagatatt cgataaagtg gccgcaaaag aaaagagaga gtttcaatct
    3501  atattaggtc tctcaaatca atttttggac atggaaaaga acgggtgcaa
    3551  aattgacata cttccttttg ctaggcaaaa tgtttttcct catcatcagt
    3601  cctcagatga tgtcactttt tgggcaggtg ttcaaaagag gataaggaag
    3651  tccaattgga ggcgtgaaaa aacaaaattt gaagaatttg agagtcaggg
    3701  gaaagaactg ctccaagagt ttatttcgat gttgcccttt gaattcaagg
    3751  ttaacattaa agacattgaa gatggagaaa aaagcttcct agaaaaaagg
    3801  aaattgaagt cagaaaaaat gtgggcgaat cattcagaaa ggtctgacat
    3851  cgactggaag cttgaccatg ccttcctctt tatgaaatca cagtattgca
    3901  cgaaggaagg gaagatgttc accgaggcga aagccggcca aactttggcc
    3951  tgcttccagc atattgtctt gttcagattc ggacccatgc tcagagcaat
    4001  tgagagcgcc tttttaagga gctgtgggga ttcatactac atacactccg
    4051  gaaaaaactt tttctgccta gacagctttg taacgagaaa tgcacatgtt
    4101  tttgatggat tttcaataga gtccgactac actgctttcg attcatccca
    4151  ggaccacgtc attttggcct tcgagatggc actattgcaa tatttgggtg
    4201  tatccaaaga atttcagctt gactatctga ggttgaagtt gactcttggt
    4251  tgtcgacttg ggtcattagc aataatgaga ttcaccgggg aattttgcac
    4301  ctttctgttc aacacatttg ccaacatgct tttcactcag ttgaagtaca
    4351  agatagaccc acggaaacat aggatcttat tcgcagggga tgacatgtgc
    4401  tccctgagct ctctcaagag gagaagagga gaaagagcaa caaggttgat
    4451  ggggagcttt tccctaactg cggtggagga agtgaggaaa ttccctatgt
    4501  tctgtggatg gtatttgagt ccatatggaa ttatcaaatc tccaaaattg
    4551  ttatgggcca ggattaagat gatgagtgaa agacagctcc tgaaagaatg
    4601  cgttgacaac tatctgtttg aggcaatatt tgcctacagg ttaggtgaga
    4651  ggctgtacac aattttgaaa gaagaagact tcgaatatca ttatcttgtt
    4701  ataagattct ttgtcaggaa ttcaaagctg ctaacgggtt taagcaagag
    4751  cttgattttc gaaattggag aaggaattgg gtctgaatgg cgatcgtcaa
    4801  tgtcaaccat ttcctcaagg aggtcgagtc aacagacctc aagattgacg
    4851  caatctcatc ctcagaactt tacaaagatg caaccttttt caagccagat
    4901  gtgctcaatt gtatcaaaag atttgagtca aatgtcaaag tttcctccag
    4951  gtctggggat ggactggtct tgtcagattt caagttgctt gatgacactg
    5001  aaatcgactc aatcaggaaa aagagcaaca agtacaagta cttgcattac
    5051  ggagtcattc tggttggaat caaagcaatg ctgccaaact tcagaggtat
    5101  ggaaggaagg gtcattgtgt atgacggagc ctgtcttaat ccggaaagag
    5151  gccatatatg ctcgtatttg tttaagtttg agtctgactg ctgttacttc
    5201  ggtcttagac ctgaacactg cttatccacc acagatgcca acctggcgaa
    5251  gagattcaga tttcgtgtgg actttgactg cccacagtat gaacaggaca
    5301  ctgagttgtt tgctcttgac attggtgtgg cctacagatg tgttaattca
    5351  gctcgtttct tggagaccaa gactggagac tcagggtgga cctcgcaggc
    5401  tattagtggc tgtgaggcac tcagatttaa tgaagaaatt aaaatggcaa
    5451  ttttggatca taagtctcca ctatttctgg aggaaggtgt tccaaatgtt
    5501  catattgaaa agaggctgtt cagaggtgac aagattagaa ggtcacgctc
    5551  aatttctgca aaaagggggc caaactcgaa accgcaggaa aagagaggat
    5601  ttaggtccct ctcagctaga attgaaagat tcggagaaaa tgagtttgga
    5651  agacgtgctt caacaagcga ggcgccaccg ggtaggagtg tatctttgga
    5701  agacacatat agacccggca aaggaacttc tgacggttcc tccccctgaa
    5751  gggtttaagg aaggtgaaag ctttgaaggc aaggagcttt accttcttct
    5801  ttgcaaccat tattgtaaat acttatttgg taatattgct gtttttgggt
    5851  catctgataa gacccagttt cctgctgttg gatttgatac ccctccggtt
    5901  cattacaatt tgacaacgac cccaaaagaa ggggaaactg aagagcaaaa
    5951  gaaggccaga gagggttcgt ctggcgaaaa aacaaaaatt tggagaatcg
    6001  acttgtcaaa tgttgtacct gaattgaaaa cctttgctgc cacttctagg
    6051  cagaactctt tgaatgaatg tacattcaga aagctttgtg agccattcgc
    6101  tgatttggcc cgtgagtttc ttcatgaaag gtggtcaaaa ggattggcca
    6151  ctaacattta taagaaatgg cccaaagctt ttgaaaaaag cccttgggtg
    6201  gcatttgatt ttgccaccgg tctaaaaatg aatcgtttaa cacctgatga
    6251  gaaacaggtg atcgacagga tgaccaaaag gctttttcgt actgaaggac
    6301  aaaaaggggt tttcgaggca ggttcggaga gtaatctgga actggagggt
    6351  taggagtcgt gtgaaattcc gcaaatttgg tcgcggtctt gcaggttgac
    6401  atgcctgcct ttatacttaa ataaagggtt cacccggttt tctgtgcatt
    6451  tccgggttag tgtggttttt ctagagtcta gagtttgtcc actct