!!NA_SEQUENCE 1.0
ID   AB011007   standard; RNA; VRL; 3591 BP.
XX
AC   AB011007;
XX
SV   AB011007.1
XX
DT   08-JAN-1999 (Rel. 58, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 3)
XX
DE   Patchouli mild mosaic virus genomic RNA, complete sequence of RNA2.
XX
KW   .
XX
OS   Patchouli mild mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Fabavirus.
XX
RN   [1]
RP   1-3591
RA   Ikegami M.;
RT   ;
RL   Submitted (02-FEB-1998) to the EMBL/GenBank/DDBJ databases.
RL   Masato Ikegami, Tokyo University of Agriculture, Nodai Research Institute;
RL   1-1 Sakuragaoka-1, Setagaya-ku, Tokyo 156, Japan
RL   (E-mail:ikegami@nodai.ac.jp, Tel:03-5477-2537, Fax:03-5477-2634)
XX
RN   [2]
RA   Ikegami M., Kawashima H., Natsuaki T., Sugimura N.;
RT   "Total nucleotide sequence of Patchouli mild mosaic fabavirus";
RL   Unpublished.
XX
DR   GOA; Q9Z006.
DR   SPTREMBL; Q9Z006; Q9Z006.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3591
FT                   /db_xref="taxon:73149"
FT                   /mol_type="genomic RNA"
FT                   /organism="Patchouli mild mosaic virus"
FT                   /segment="2"
FT   CDS             221. .3415
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9Z006"
FT                   /db_xref="SPTREMBL:Q9Z006"
FT                   /product="polyprotein"
FT                   /protein_id="BAA36400.1"
FT                   /translation="MRPELVAVLDRYFTEVISCFFLGWLINFLLVWFNSARSAFLLWSV
FT                   FLYVSYYILRIEFAYIVAPFLKTIYTNSSQYHIVDWENAYTALPKGLWEQITDYNYCFN
FT                   FPSPSVEGFVSDFSPRFTLKELEIMNEANITPVHTIPKDTLLKRASDYKLAVESKKSIL
FT                   PKVQDLYEMDKWHTLKSKLSKNAPSYVTTSEIVVGAMSGAGNTKLAIPIVEKYTEEVAD
FT                   DRLPDRVRAKADQIMVAAIELVADGFASVNSDVTMAGALYDKRHKTIASSFKGAFASRA
FT                   SGVPSHVIYFPMHRVPSSDDPNTTLELSMVSRDSDFDEGYTLANISARTLYVRAKGPEK
FT                   VTETRHLLKAKTEDVVKARQFASEAQVVFATPRLFPEVNLDNYNLPGPSNVQQTEAITT
FT                   DRGILCPKPKFKGNEVVLNYTGSAKVRGHGSQRFEKKDVAGEQFVRSVEDLGCLSDEDG
FT                   KDYRYGQGLMEEDVLNVQTNNFAIESATETMRLLFSGYASIPLNVIPGTKITVAYLNEL
FT                   SKHSAVHTGLLNMLSKIPGSLKVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLG
FT                   IQHYKWNPAIEPYVEFCFQAFFLCRLVEHALFRVFQICSCGGHTDIVQVAERSEVDARI
FT                   SFAIYYEPTITLPKQIATLEHAPAFMFRKELGTLAFKQGELVAYSFEVNFGKPQTDGKE
FT                   VTSTFASAYCGLSQYIQSDVILDFTLMSSPMIGGTFSIAYVAGAYIEKVGNMQILDSLP
FT                   HIDFTFSSGSKSTRSVRFPKEVFGVYQALDRWDLDSARGDDVSGNFVLYQRDAVSSALE
FT                   GELTFRIAARLSGDITFTGVSAGYPTTITRIGKGKTIGRSLDPEIRKPLRYMLGQAHTT
FT                   PKDFSSVRFVMGHWKYKAGLYPGSKSDEDIHPFSLKMRLDGSKSSENFEIIHSPFVRLL
FT                   QNCAWMRGTLKFYIVARASSDYMSYRRTSQLTVSAHENSLSSNQFYSGVLMSPSGELSF
FT                   SREVVGPVDGFASMGWNVRGSKKFYKIHVEMGNVHEYDSVVLYGQFGTDVEFAGQQKGG
FT                   HYLLEKETPIFKTIKY"
XX
SQ   Sequence 3591 BP; 1021 A; 657 C; 852 G; 1061 T; 0 other;

 AB011007  Length: 3591  July 15, 2003 09:22  Type: N  Check: 6054  ..
       1  taataataaa atattaaacc aaacagcttt cgttccgaga aaacagcttt
      51  cagttacaaa acagctttca gttacataac agctttcaga tactttgaag
     101  tttcaaattg aacccggaaa aagggagtgt gattcaaagc gcaccatata
     151  ttttgaaaac ttcatctttt agttttgtta gtgcattatc attcaaaatt
     201  ttgattttga atatgttgta atgcgtcctg aacttgttgc agtgttagat
     251  agatacttta cagaagtcat aagttgtttc ttcttgggtt ggttaataaa
     301  ttttctactc gtttggttta attcagcaag aagtgctttc ttgttgtggt
     351  cagttttctt atacgtttca tattacatat tgagaatcga atttgcatat
     401  atcgttgcgc ccttcttaaa aacgatatac acaaatagtt ctcaatacca
     451  cattgtagat tgggagaacg catacacagc tttacctaaa ggactgtggg
     501  agcaaattac tgattacaac tattgtttca acttcccatc cccttctgtc
     551  gaaggttttg tgtctgattt ttcaccgcga tttacactca aagaacttga
     601  gatcatgaat gaagcgaata ttactccggt acacacgatt ccaaaggaca
     651  cattgcttaa gagagcaagt gattacaagc tggctgtgga gagcaagaag
     701  tccatcttac ctaaagtgca agacttgtac gagatggaca aatggcacac
     751  tttgaagagc aagttgagta agaatgctcc tagttacgtc acgacttcag
     801  aaatagtagt cggtgcgatg tcaggagcag gaaatacgaa attagcaata
     851  ccgattgttg aaaagtacac cgaggaggtg gcagatgaca ggttgcctga
     901  tagagttcgt gccaaagccg atcaaataat ggtcgcagcc attgagttgg
     951  tggcagatgg ttttgcctca gtcaattcgg atgtgactat ggctggagca
    1001  ctctatgata agcgtcacaa gaccattgcg agttctttca agggtgcttt
    1051  tgcatctaga gctagcggtg ttccttcgca cgtcatttac tttcctatgc
    1101  atagagttcc ttcgagtgat gatccaaaca caactctaga gctttcaatg
    1151  gtgagccgag attcagattt tgatgaaggt tacacgctgg ccaatatctc
    1201  agctcgcact ctttacgttc gcgcaaaggg acctgaaaag gttacagaaa
    1251  caaggcatct tttgaaggcc aaaactgagg atgttgtgaa agcgcgccag
    1301  tttgcaagtg aggcacaagt tgtatttgcc acgcctcggt tgtttcccga
    1351  agtgaatttg gacaattaca atttgcctgg acctagcaat gtgcagcaga
    1401  cggaggccat cactactgat agaggaatat tgtgcccgaa gccaaaattt
    1451  aaaggaaatg aggtggtgct caattacaca ggttcggcta aggttagggg
    1501  ccatggctca cagagatttg agaagaaaga cgttgctggt gagcaattcg
    1551  ttagaagcgt tgaagatcta ggatgtttgt ctgatgaaga tggcaaggat
    1601  tataggtatg gccaaggctt aatggaggaa gatgtgctga atgtgcagac
    1651  gaacaatttt gctatagaat cagccacgga gaccatgcgc ttgttattta
    1701  gtgggtacgc aagcattcct ttgaacgtta taccgggtac caaaatcacg
    1751  gtggcctact tgaatgaatt gtctaaacat agtgcagtgc acactggtct
    1801  gttgaatatg ttgagcaaaa ttccaggctc tttgaaggtt aagattaatt
    1851  gccaggtggc cccaacatgt ggaattggat tggcagttag ttatgttgaa
    1901  ggaaatgaaa gtgcgaattt gggatctagc ctgggacgct tgttaggcat
    1951  tcagcactac aagtggaacc cagctataga accgtatgtg gaattttgtt
    2001  ttcaagcctt tttcctgtgc agattggtgg aacatgcatt atttagggtc
    2051  tttcaaatat gctcctgtgg tggtcataca gacattgtcc aagtggctga
    2101  acgctccgaa gtggatgcca gaattagttt tgcaatatac tatgagccta
    2151  ccatcacatt gcccaagcag atagctaccc tagagcatgc cccagcattt
    2201  atgtttcgca aggagttagg gacactggct ttcaagcaag gggaactcgt
    2251  ggcttactca tttgaagtca attttggcaa accacaaact gacggaaagg
    2301  aagtgacttc aacttttgca tcggcttatt gcggccttag ccaatatata
    2351  caatcagatg tcattttgga ttttaccctc atgagcagtc ctatgattgg
    2401  aggaactttc tcgattgcat atgtcgcagg agcctacatt gaaaaggttg
    2451  ggaacatgca aattctagat tccttgcctc acattgattt cacattctct
    2501  tcaggatcta agagcacgcg ctctgtgcga tttcccaagg aagtctttgg
    2551  ggtgtatcaa gcacttgata ggtgggattt ggattcggca agaggagatg
    2601  acgtctcagg taattttgtg ctttatcaga gagatgcggt ttcgagtgcc
    2651  ttggaaggag aacttacctt cagaatagct gcccgcttat ctggagacat
    2701  cacctttaca ggcgtgagtg caggctaccc aacgacaatt acgcgcatag
    2751  gaaaaggtaa aaccataggg aggtcactcg atcctgagat taggaagcct
    2801  ctgaggtaca tgcttggtca agcacataca acacccaaag attttagctc
    2851  agtgcgtttt gtgatgggtc actggaaata caaagcaggt ttatatcctg
    2901  gaagcaagtc agatgaggat attcatcctt tttccttgaa aatgcgtctt
    2951  gatggttcta agagcagtga gaactttgaa atcatacatt ctccttttgt
    3001  gcgtctattg cagaattgcg cgtggatgag aggtactttg aaattctaca
    3051  tcgtggctcg tgctagttct gattatatga gttacagaag gacatcgcag
    3101  ttaactgttt cagcacacga gaacagtctc agctccaacc aattttatag
    3151  cggagttttg atgagcccta gtggtgaatt gagcttttct agagaggtgg
    3201  ttggcccggt ggatggtttt gcttccatgg gctggaatgt gcgtggtagc
    3251  aagaagtttt ataaaattca tgtggagatg gggaatgttc atgagtacga
    3301  ttctgtagtg ttgtatggac aatttggcac tgatgtcgaa tttgctggcc
    3351  aacaaaaggg tggacattat ttattggaaa aagaaactcc tattttcaaa
    3401  acaatcaagt attaataacg tgagaagtta tttggtgttt gaatttgaat
    3451  aaaaaggcgt aggtcactag cctcccatta aaatgggttc catgaccttt
    3501  gtgagatgtg taatatttac tactcttaaa acacatgtgt attgtgttag
    3551  gttaaagcat cctttatatg tataagcttt agtagtattt t