!!NA_SEQUENCE 1.0
ID   AB013615   standard; RNA; VRL; 5957 BP.
XX
AC   AB013615;
XX
SV   AB013615.1
XX
DT   14-DEC-1998 (Rel. 58, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 4)
XX
DE   Broad bean wilt virus 2 genomic RNA, complete sequence of RNA1.
XX
KW   polyprotein.
XX
OS   Broad bean wilt virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Fabavirus.
XX
RN   [1]
RP   1-5957
RA   Nakamura S.;
RT   ;
RL   Submitted (06-MAY-1998) to the EMBL/GenBank/DDBJ databases.
RL   Shigeo Nakamura, Miyagi Prefecture Agricultural Research Center, Department
RL   of Plant Biotechnology; Takadate-kawakami, Natori, Miyagi 981-1243, Japan
RL   (E-mail:gene-2@sh.comminet.or.jp, Tel:81-22-383-8131, Fax:81-22-383-9907)
XX
RN   [2]
RA   Nakamura S., Iwai T., Honkura R.;
RT   "Complete nucleotide sequence and genome organization of broad bean wilt
RT   virus 2";
RL   Nippon Shokubutsu Byori Gakkaiho 64:565-568(1998).
XX
DR   GOA; Q9YM10.
DR   SPTREMBL; Q9YM10; Q9YM10.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5957
FT                   /db_xref="taxon:76875"
FT                   /mol_type="genomic RNA"
FT                   /organism="Broad bean wilt virus 2"
FT                   /isolate="MB7"
FT                   /segment="1"
FT   CDS             235. .5847
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9YM10"
FT                   /db_xref="SPTREMBL:Q9YM10"
FT                   /transl_table=1
FT                   /product="polyprotein"
FT                   /protein_id="BAA34928.1"
FT                   /translation="MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKVDEKDKTLLHIHLCF
FT                   LHANEMARDLNEGIDVSQIHSSSAIKYRAAIVTRHVKMNVETGRYDRKRMVEYNNETCI
FT                   NWFSCEFMEVKEENQELLVGEGRVEEIVDEFLANCNVSERNDQVSTVINANYAFGQGLY
FT                   EYATRVSDAIVAVISGSIKKGIDEFLDKVYTTMNQIFAAWMPKIRAAFQWFENIKEVVK
FT                   KWVNTMHEKINCILVGMEDCLYMGAGLVAATCIVTLLEKFMVAIGILTKPCGAATLFLT
FT                   TAMAAISAAYVCSKAVEKSVMLTNLLHFVTSNCQIVLSALFNHDATKKELTAIQDGSEA
FT                   PIGLGQFGVSTMLQDVANLMSTWSTNSVTEIGRTFGAISQIKNGILALKDMIYFVFEKL
FT                   SDLAHKVLGFESQVLADLTILLGENVADWLSECDCMVSYMLEFNSRNREIFDRLSQLIE
FT                   KGRLIRTGVLRTGHRGSSQVMALVTKALEKLIELHNSVVMSGSNTTRKSPFMVFFTGAS
FT                   GTGKTSVVQRVAINWLQEEQLGTNEIYSRNGQDPFWSGYKRHAVVTYDDFGAVPGTTSN
FT                   EAEIINVISRNPYATVMAGLAEKGMYFDSRLVLASSNFLAANPESGVHDSEAYERRRHA
FT                   VIRVSLKPGVPYNADDPCANQTYTLLESKTPFREIQTFETYAELWSYLYTSFKEHEVQE
FT                   ELYLKSLPILDSDKKEALEGLVGLTVIATSFAPKAVMQYGVEKFPGYHFLVSDGEKCYF
FT                   WHGDGSVESASVEQMQLSKQDVVQLKQQGLSTAMMYKDLAKAFPTLNSLAVLYAKNIVV
FT                   KRWVGPDLEPMKSCEDVYMREQIGNLPKWQRAYLYVLSKYLTTQSPRGWFMECLEETKK
FT                   NLRATYLWEYKQWPLPLKLALGSLIAIMAGGAIWYSLQSLWCMSGDASFVAGAATVFSV
FT                   SSFAGQSDIPNRDNSERSFRNRKVRARTWQGQSSCFGDSALWIAETCMATLTFSNVRTQ
FT                   VCLAPGRGFFGVNHCLAAIPAGVMVKMDSSIGVTYFVWEKEKLMQFDGNEIALYLTSTL
FT                   PKTVDSLLGRIHFDVETLPKTFNAVFFSYKYDPMIQQMVPELGSVTCKVHNKAYTLAHG
FT                   EYRREIPQSLSYEASTVAGDCGSLILAEIDGKFKLVGMYVAFNGREGSASFIPYHARLD
FT                   QKVGQGEFVLKYQEWAEPKILGPGCRAMGLIEPEHALAASGKTTFVETPDEWHLDYPCD
FT                   KLPSVLTRGDPRLAGTVHADYDPFASGMSKYAKEAGPFDAASLKQVCSGIVEIWEDASA
FT                   DFPMDEVDLDTAINGLENVEFFDALVLGTSEGFPYRLDRGPGDKGKSRYVSGESGNLKI
FT                   TDEGVLSDIAWFEEVSKTQVPDLYCIECVKDERLPIRKVLHEPKSRLFTVLPMSYNIVI
FT                   RKKFLNFVRFFMKRRDVLPAQVGINPYSREWTRMANKLLSKGNNILCCDYSRFDGFLPK
FT                   CIMNEIGNMIARLMKVDEVSRAQIKNLMLACTSRYAMCNRVLYRVENGIPSGFPLTVIV
FT                   NSILNEILVKYAYWHCFEDNPSVQSNFDAHVSMVVYGDDNLISVSDAISSKFDGSFLVS
FT                   FMEGLGIKVTDGIDKTKVGIEFRRLENCDFLKRSFKMSPDGTWRSPMSKESLWPQLHFV
FT                   KAKKLEMAEAYINNCNNILRELWLHDVKEAKEFRNKVLRNLRWVGHEQLLNMQQLAVFH
FT                   SEQMNGVSDFLSTCVTVDSIPLMDPLVPGMLPVKTCEIIPRIFVAAEKHFEGNFNNFFT
FT                   ISITTSRKFEEDKGFVLLFPYGAGRGGLPTTQFMRENVIRKGCSIQKKFRQAYEKGNNI
FT                   LFISQSSVVPAYVFAVMLLHSIGAITRLSSNKALTQAMQTCKRLEYLPKEYEEFF"
XX
SQ   Sequence 5957 BP; 1694 A; 1002 C; 1537 G; 1724 T; 0 other;

 AB013615  Length: 5957  July 15, 2003 09:17  Type: N  Check: 5837  ..
       1  tgttttaata aaatattgaa acaaacagct ttcgttccga aaaacagctt
      51  tcagttacta aacagctttc gttccgataa aacagctttc agaaacaaac
     101  agctttcaat tttctttcgg aaaatttagt tactgcgtga ctttggaaag
     151  aacccggaaa aagggagtgt gatttaaagc gcaccatata tttcaaagat
     201  catattgatt tcattttgct accttaattt taaaatggat ttcagtacga
     251  tgcaagtggt tgtgggtttt ttgaagactt cgatgggttt acaatccatt
     301  cgagacattg tgcagaaagc aaaggtggat gagaaagaca aaacattgct
     351  tcacatccac ctgtgttttc tccatgccaa tgagatggcc cgagatttga
     401  acgaaggcat agatgtgagc cagatacata gctcttcagc tattaagtat
     451  cgggccgcaa ttgttacgcg ccatgtgaag atgaatgtgg aaaccggaag
     501  gtatgatagg aaacgcatgg tggaatacaa caatgaaaca tgtatcaatt
     551  ggttttcttg tgaattcatg gaggtaaaag aggagaatca ggagctacta
     601  gttggagaag gtcgtgtgga agaaattgtt gacgagtttc tagcaaactg
     651  caacgtctcc gagcgcaatg atcaagtgtc cactgtgata aatgccaatt
     701  atgcatttgg ccagggattg tatgagtacg caactcgtgt cagtgatgca
     751  atagtggcag tgatttcagg atcaatcaag aaaggcatag atgagttttt
     801  ggataaagtg tacacgacta tgaatcagat ttttgcagcg tggatgccca
     851  agattagagc tgcttttcag tggttcgaga atatcaaaga ggtcgtgaag
     901  aagtgggtaa acacaatgca cgagaagata aattgcattt tggtaggtat
     951  ggaggattgc ctttacatgg gagctggact cgttgcagct acatgtattg
    1001  tcacattgct tgaaaagttc atggtggcaa ttggcatcct taccaagcct
    1051  tgcggagcag cgactttgtt tttgacgact gctatggcag ctatttctgc
    1101  cgcatatgta tgttccaagg ctgtggagaa gtcggttatg cttaccaatt
    1151  tgctacactt tgtgacttcc aattgccaaa ttgtgttgag cgctttattc
    1201  aaccatgatg cgacaaagaa agagttgaca gcgatccaag atggaagtga
    1251  agcaccaata ggccttggcc agtttggagt ttcaacgatg ttgcaagacg
    1301  tggcaaactt gatgtcaacg tggtccacaa attcagtcac tgaaattgga
    1351  agaacatttg gtgctatctc gcagatcaag aatggtattt tagccttgaa
    1401  agacatgatt tattttgtgt tcgagaagtt gagtgactta gctcataaag
    1451  tgttgggctt tgaatctcaa gttttggctg atctcacaat tcttttgggt
    1501  gagaacgttg cagattggtt gtccgagtgc gactgcatgg tctcttatat
    1551  gcttgagttt aactcaagga atagggagat atttgatagg ctctcacaac
    1601  tcattgagaa aggcagactt atacgcacag gagtgttgag gacaggccat
    1651  cgtggctctt cgcaggtcat ggcacttgtc accaaagcct tagagaagct
    1701  gatagagttg cacaattcag tagtgatgtc tggatccaat accactagga
    1751  aatccccctt tatggttttt ttcacaggtg cttcgggtac agggaaaact
    1801  tcggttgtgc agagggtagc catcaattgg ttgcaggagg aacaactggg
    1851  cacaaatgag atatattcgc gcaatgggca ggaccctttt tggtcaggtt
    1901  acaagagaca cgcagttgtc acgtatgatg attttggcgc tgttccaggt
    1951  acaacctcga atgaagctga aattatcaat gtgatatcga gaaatccata
    2001  tgccacagtc atggcaggat tggcggagaa aggcatgtac ttcgattcga
    2051  gattagttct agctagtagt aattttctgg ctgctaaccc cgagtcagga
    2101  gttcatgatt cagaggcata tgaacggcgc agacatgcgg ttattagagt
    2151  ttctctcaag cctggagtgc cttataatgc agatgaccca tgtgccaatc
    2201  agacgtacac cttgcttgag tccaaaacac cttttaggga gatacaaaca
    2251  tttgagactt atgcagaact atggtcttat ttgtacacaa gcttcaagga
    2301  gcatgaggtg caggaggagt tgtatttgaa atccttgccc attttggatt
    2351  cagataagaa agaagctttg gaaggccttg tgggtcttac agttatagcc
    2401  acttcatttg ctcctaaggc agtaatgcaa tatggagttg aaaaattccc
    2451  agggtaccat tttttggttt ctgatgggga gaagtgttat ttctggcatg
    2501  gagatggttc agtggagagt gctagtgtgg agcagatgca attgagtaag
    2551  caagatgtgg tgcaattgaa gcaacaagga ctgtcgacag caatgatgta
    2601  caaggactta gctaaagctt tcccaacttt gaattcattg gctgtgctgt
    2651  atgccaagaa catcgtagtg aaacgttggg tggggcctga cttggaaccc
    2701  atgaaaagtt gtgaggatgt ttacatgagg gagcaaatag gcaacttgcc
    2751  gaaatggcaa agggcatatt tgtacgtgct tagcaagtat ttgacaactc
    2801  aaagtccacg tggctggttc atggagtgtc ttgaggagac aaagaagaat
    2851  ttgagagcga cctatttgtg ggagtacaag caatggccat tacctttgaa
    2901  attggctttg ggttctttga tagccatcat ggcaggtgga gcaatttggt
    2951  attcacttca atctttatgg tgcatgtcag gagacgcctc ttttgtggca
    3001  ggagcagcga cggttttttc agtttcttca tttgctggac agagtgatat
    3051  tcctaatcga gataattcag agagatcatt tagaaatagg aaggtgcgtg
    3101  ctaggacgtg gcaaggtcaa agttcatgtt tcggcgactc agctttgtgg
    3151  attgccgaga catgtatggc gacattgaca ttctctaatg ttaggacgca
    3201  agtgtgcttg gctcctggca gaggattctt tggagtgaat cattgtctcg
    3251  cagcgattcc cgcaggggtt atggtgaaaa tggattccag tattggagtg
    3301  acctattttg tgtgggagaa ggaaaagttg atgcaatttg atggaaatga
    3351  gatagccttg tacttgacaa gcactttacc taagacggtg gactctcttt
    3401  tagggaggat tcattttgat gtggaaactt tgcccaagac ttttaatgct
    3451  gttttctttt cttacaagta tgatccaatg attcaacaga tggtgcctga
    3501  acttgggagt gttacatgca aagtccacaa taaggcttac acgcttgctc
    3551  atggtgagta caggagggaa attccccaaa gtctttcata tgaagctagc
    3601  actgtagccg gagattgtgg ctctttgata ttggcagaga ttgatggaaa
    3651  attcaagctt gttggcatgt acgtggcttt caatggaaga gaaggaagtg
    3701  caagtttcat accctatcat gctagattgg accagaaggt tggccaagga
    3751  gagttcgtgt tgaagtacca ggaatgggca gaacctaaga ttctggggcc
    3801  agggtgtaga gcaatgggtc tcatagaacc agagcatgct ttagcggcta
    3851  gcggaaagac aacatttgtt gagacaccag atgaatggca tctagattac
    3901  ccgtgtgata aacttccaag tgtgctgact cgaggagatc caagattggc
    3951  aggaacagtc catgcagatt atgacccatt tgcttctggg atgagtaagt
    4001  acgctaagga ggcaggtcct tttgatgcag ccagtcttaa gcaagtgtgt
    4051  tcaggaattg ttgagatatg ggaggatgct tcggcagatt ttcccatgga
    4101  tgaggtagat ttggacactg ctattaatgg tttggagaat gtggaattct
    4151  ttgatgcttt ggttcttgga acgtcagagg gatttcctta tcggcttgat
    4201  cgtggtcctg gtgacaaggg taagagcagg tacgtgtcgg gagagagtgg
    4251  caacttgaaa ataactgatg aaggagtcct ttcagatata gcttggtttg
    4301  aagaagtgag caaaactcag gtaccagatc tttattgcat tgagtgtgtg
    4351  aaagatgaac gtttgccgat ccggaaagtg ttgcatgaac ccaagagcag
    4401  gttgttcaca gtgctaccaa tgtcttacaa catcgttatc agaaagaaat
    4451  ttctgaactt tgttagattc ttcatgaaaa ggcgtgatgt gctaccggct
    4501  caagttggga ttaatcctta ctcacgagaa tggacccgaa tggctaacaa
    4551  gttgctgagc aaaggaaaca acattttgtg ctgtgactac agtagatttg
    4601  atggcttttt gcccaagtgc attatgaacg agataggcaa catgatagct
    4651  aggctcatga aagttgatga agtgtcaaga gcccagataa agaacttaat
    4701  gctagcatgc actagtaggt atgccatgtg caacagagtc ttatacagag
    4751  ttgaaaatgg catcccatca gggtttccct tgacagtcat tgtgaattcc
    4801  atcttgaatg aaatcttggt taagtatgcg tattggcact gttttgaaga
    4851  caacccgagt gtgcagagca actttgatgc ccatgtgtcg atggttgttt
    4901  atggggatga caatttgatt tctgtgtcag acgcaattag ttcaaagttt
    4951  gatgggagtt ttcttgtgag tttcatggaa ggcttgggga ttaaagtgac
    5001  tgatgggatt gataaaacaa aggtcggaat tgaatttcgg agactggaga
    5051  attgtgattt cttgaaacgt tctttcaaga tgagcccgga tggtacctgg
    5101  cgtagtccca tgtctaaaga gagtttgtgg ccacaattgc attttgtcaa
    5151  ggcaaagaaa ttagaaatgg cagaggcata catcaacaat tgcaataata
    5201  ttttgcgtga attgtggttg catgacgtta aagaggccaa agagtttcgc
    5251  aataaagtct tgaggaattt gagatgggtt ggacatgagc aattgctaaa
    5301  catgcagcag ttggcagttt tccacagtga gcaaatgaat ggagtgagcg
    5351  actttttgtc aacttgtgtt acagtggata gcataccatt gatggatcct
    5401  ttggtgcctg gaatgttgcc agtcaaaaca tgtgagataa tcccccgaat
    5451  ttttgtggcg gcagagaaac attttgaagg gaatttcaat aatttcttca
    5501  cgatttcaat aaccacaagc cgcaagttcg aagaagataa gggatttgtt
    5551  cttttgtttc cgtacggagc tggaagagga ggattgccaa ctacgcaatt
    5601  catgagagag aatgtcataa ggaaaggatg ctcgattcag aagaagttta
    5651  ggcaggcgta tgagaaagga aataatattc tcttcatttc acagagttca
    5701  gtagttcctg cttatgtttt tgctgtgatg ctattacatt ccataggggc
    5751  aatcactaga ttatcaagca ataaagcact cactcaagcg atgcaaactt
    5801  gcaagaggtt ggagtattta cctaaagagt atgaagaatt cttttgattt
    5851  tgtgcgtgtt ttgtgtgtat attttatgta aatcactact tttgattgta
    5901  taatatgtat tatgcaggtt gaaatgcctt ttcccaagta aatttcagta
    5951  gtgaggg