!!NA_SEQUENCE 1.0
ID   AB013616   standard; RNA; VRL; 3589 BP.
XX
AC   AB013616;
XX
SV   AB013616.1
XX
DT   14-DEC-1998 (Rel. 58, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 4)
XX
DE   Broad bean wilt virus 2 genomic RNA, complete sequence of RNA2.
XX
KW   polyprotein.
XX
OS   Broad bean wilt virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Fabavirus.
XX
RN   [1]
RP   1-3589
RA   Nakamura S.;
RT   ;
RL   Submitted (06-MAY-1998) to the EMBL/GenBank/DDBJ databases.
RL   Shigeo Nakamura, Miyagi Prefecture Agricultural Research Center, Department
RL   of Plant Biotechnology; Takadate-kawakami, Natori, Miyagi 981-1243, Japan
RL   (E-mail:gene-2@sh.comminet.or.jp, Tel:81-22-383-8131, Fax:81-22-383-9907)
XX
RN   [2]
RA   Nakamura S., Iwai T., Honkura R.;
RT   "Complete nucleotide sequence and genome organization of broad bean wilt
RT   virus 2";
RL   Nippon Shokubutsu Byori Gakkaiho 64:565-568(1998).
XX
DR   GOA; Q9YM09.
DR   SPTREMBL; Q9YM09; Q9YM09.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3589
FT                   /db_xref="taxon:76875"
FT                   /mol_type="genomic RNA"
FT                   /organism="Broad bean wilt virus 2"
FT                   /isolate="MB7"
FT                   /segment="2"
FT   CDS             222. .3416
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9YM09"
FT                   /db_xref="SPTREMBL:Q9YM09"
FT                   /transl_table=1
FT                   /product="polyprotein"
FT                   /protein_id="BAA34929.1"
FT                   /translation="MRPELVAVLDRYFTEIISCFFLGWLINFLLVWLSSAKSAFLLWSV
FT                   SLYVLYYILRIEFAYIVAPFLKTIYTNSSQYHIVDWENAYTALPKGLWEQITDYNYCFN
FT                   FPPPSIKGFASDFSPRFTLKELEIMSEANITPVHTIPKDTLLKRASDYKLAVESKKSIL
FT                   PKVQDLYEMDKWHTLKSKLSKNAPSYVTTSEIAVGAMSGAGNTKLAIPIVEKYTEEVAD
FT                   DRLPDRVRAKADQIMVAAIELVADGLASVNSDVTMAGALYDKRHKTIASSFKGAFASRA
FT                   SGVPSHVIYFPMHRVPSSDDPNTTLELSMVSRDSDFDEGYTLANISARTLYVRAKGPEK
FT                   VTETRHLLKAKTEDVVKARQFASEAQVVFATPRLFPEVNLDNYNLPGPSNVQQTEAITT
FT                   DRGIFFPKPKFKGNEVVLNYTGSAKIKDHGSQRFEKKDVFGNQFVRSVEDLGCLSDEDS
FT                   KDYRYGQGLMEEDVLNVQTNNFAIESATETMRLLFSGYASIPLNVIPGTKITVAYLNEL
FT                   SKHSAVHTGLLNMLSKIPGSLKVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLG
FT                   IQHYKWNPAIEPYVEFVFKPFSCADWWNMHYLGSFKYAPVVVIQTLSKWLNAPKVDARI
FT                   SFAIYYEPTIMLPKQVATLEHAPAFMFRKELGTLAFKQGERVAYSFEVNFGKPQTDGKE
FT                   VTSTFASSYCGLSQYMQSDVILDFTLMSSPMIGGTFSIAYVAGAYIEKVGNMQILDSLP
FT                   HIDFTFSSGSKSTRSVRFPKEVFGVYQALDRWDLDSARGDDVSGNFVLYQRDAVSSALE
FT                   GELTFRIAARLSGDINFTGVSAGYPTTITRIGKGKTIGRSLDPETRKPLRYMLGQAHAT
FT                   PKDFSSVRFVMGHWKYKAGLYPGSKSDEDIHPFSLKMRLDGSKSSENFEIIHSPFVRLL
FT                   QNCAWMRGTLKFYIVARASSDYMSYRRTSQLTVSAHENSLSSNQFYSGVLTSPSGELSF
FT                   SREVVGPVDGFASMGWNVRGSKKFYKIHVEMGNVHEYDSVVLYGQFGTDVEFAGQQKGG
FT                   HYLLEKETPIFKIIKY"
XX
SQ   Sequence 3589 BP; 1016 A; 655 C; 860 G; 1058 T; 0 other;

 AB013616  Length: 3589  July 15, 2003 09:22  Type: N  Check: 2022  ..
       1  tgttttaata aaatattaaa acaaacagct ttcgttccga gaaaatagct
      51  ttcagttaca aaatagcttt cagtttcaca acagctttca gacactttga
     101  agtttcaaat tgaacccgga aaaagggagt gtgattcaaa gcgcaccata
     151  tattttgaaa acttcgtttc ttaatttgat agtgcataat cattcggaat
     201  tttgatttcg gatatgttgt aatgcgtcct gaacttgtcg cagtgttgga
     251  tagatacttc acagagatca taagttgttt cttcttgggt tggttaataa
     301  actttttact tgtttggtta agttcagcga aaagcgcctt cttgttgtgg
     351  tcagtttccc tgtatgtatt atactacata ttgagaattg aatttgcata
     401  tatcgttgcg cccttcttaa aaacgatata cacaaatagt tctcaatatc
     451  acattgtaga ttgggagaac gcatacacag ctttacccaa aggactgtgg
     501  gagcagatta ctgattacaa ttactgtttc aactttcctc ctccttccat
     551  aaaaggtttt gcatctgatt tttcaccgcg tttcacactt aaagaacttg
     601  aaatcatgag tgaagcgaat attactccgg tacacacgat tccaaaagat
     651  acattgctta aaagagcaag tgattacaaa ctggctgtgg agagcaagaa
     701  atctatcttg cctaaagtgc aagatttgta cgagatggac aaatggcaca
     751  ctctgaaaag caaattgagt aagaacgctc ctagctacgt cacgacttca
     801  gagatagcag ttggtgcgat gtcaggagcg ggaaacacga aattggcaat
     851  accaattgtg gagaagtaca ccgaggaggt ggcggacgac agattgcctg
     901  atagagttcg tgccaaagct gatcagataa tggttgcagc tattgagtta
     951  gtggcagatg gtttggcctc agttaattca gatgtgacta tggctggagc
    1001  actctatgat aagcgtcaca agactattgc aagttccttc aaaggtgctt
    1051  ttgcatctag agctagtggt gttccgtcgc acgtcattta ctttccgatg
    1101  catagagttc cttcgagtga tgatccaaat acaactttgg agctttcaat
    1151  ggtgagccgg gattcagatt ttgacgaagg ttacacgctg gccaatattt
    1201  cagctcggac cctttatgtt cgtgcgaaag ggcccgaaaa ggtaacagag
    1251  acaagacatc ttttgaaggc caaaactgag gatgttgtta aagcgcgcca
    1301  atttgcaagt gaagcacaag tcgtattcgc cacaccccgg ctgttccctg
    1351  aagtgaattt ggataactac aatttgcctg gacctagcaa tgtgcagcag
    1401  acggaggcca ttactactga tagaggaata tttttcccca agcccaaatt
    1451  caagggaaat gaggtggtgc tcaattacac aggatcggca aagattaagg
    1501  accatggctc acagagattt gagaagaaag acgtttttgg taaccaattt
    1551  gttaggagcg ttgaagatct aggatgttta tctgatgagg atagcaagga
    1601  ttataggtac ggtcaaggtt taatggagga agatgtgctg aatgtgcaaa
    1651  caaacaattt tgctatagag tcagctacgg aaaccatgcg cttgctattt
    1701  agtggatacg caagtatacc tttgaacgtc atacctggga ccaagattac
    1751  ggtggcctac ttgaatgaat tgtccaaaca tagtgcagtg catactggtt
    1801  tgctgaatat gttgagcaaa attccaggct ctttgaaggt caaaattaac
    1851  tgtcaggtgg ccccaacgtg cggaattgga ttggcagtga gttatgttga
    1901  gggaaatgag agtgcgaatt tgggttctag tttgggacgc ctgctaggta
    1951  ttcaacatta caagtggaat ccagctatag aaccgtatgt ggagtttgtt
    2001  ttcaagcctt tttcttgtgc ggactggtgg aatatgcatt acttaggatc
    2051  tttcaaatat gctcccgtgg tggttataca gacattgtcc aagtggctga
    2101  acgccccaaa ggtggatgct agaattagtt ttgcaatata ctatgagcct
    2151  accatcatgc tgcccaagca agtagcaacc ttggagcatg ccccggcatt
    2201  tatgtttcgc aaggagttgg ggacgttggc ttttaagcaa ggggagcgtg
    2251  tggcttactc atttgaagtc aattttggta aaccacaaac tgacggaaag
    2301  gaggtgactt caacttttgc atcatcttat tgtggcctta gccaatatat
    2351  gcaatcagat gtcattttgg atttcactct catgagcagt cctatgattg
    2401  gcggaacttt ttcgattgca tacgttgcag gagcttacat tgagaaggtt
    2451  ggaaacatgc aaattctaga ttccttgccc catattgatt tcacattttc
    2501  ttcaggatct aagagcacgc gctctgtgcg ctttcctaag gaggtttttg
    2551  gggtgtatca ggcacttgac aggtgggatc tggattcagc aagaggggat
    2601  gatgtttcag gcaattttgt gctttatcaa agggatgcgg tttcgagcgc
    2651  tttggaaggg gaacttactt tcagaatagc tgcccgctta tctggagaca
    2701  tcaacttcac aggcgtaagt gcaggctacc caacaacaat tacgcgcata
    2751  gggaaaggca aaaccatagg gagatcactt gatcctgaga ctaggaagcc
    2801  tctgagatac atgcttggac aagcacatgc aacacccaaa gatttcagct
    2851  cagtgcgttt tgtaatgggt cattggaagt acaaagcagg cttgtaccct
    2901  gggagcaagt cagatgagga tattcatcct ttttctctga aaatgcgtct
    2951  cgatggttct aagagcagtg agaactttga aatcatacat tctccttttg
    3001  tgcgtctgtt gcagaattgc gcatggatga gaggcacttt gaaattctac
    3051  attgtggccc gtgctagttc cgattatatg agctacagaa ggacatcgca
    3101  attgactgtt tcagcgcatg aaaatagtct cagttccaac caattttata
    3151  gtggagtttt gacgagccct agtggtgagt taagcttctc tagagaagtg
    3201  gttggcccag tggatggctt tgcctccatg ggttggaatg tgcgcgggag
    3251  caagaaattt tataaaattc atgtggagat ggggaatgtt catgagtacg
    3301  attctgtggt gttgtatgga caatttggca ctgacgtcga atttgctggc
    3351  caacaaaagg gtggacatta tctgttagaa aaagaaactc ctattttcaa
    3401  aataatcaag tattaataat ttgagtggtt atttgatgtt tgagtttgaa
    3451  taaaaaggcg taggtcacta gcctcccatt aaaatgggtc catgacctgt
    3501  gtgtaatttg tgacatttac tactttaaaa cacatgtgtg ctgtgttagg
    3551  ttaaagcttc ctttgtatgt ataagcttta gtagtattt