!!NA_SEQUENCE 1.0
ID   AB018600   standard; genomic RNA; VRL; 845 BP.
XX
AC   AB018600;
XX
SV   AB018600.1
XX
DT   21-OCT-1998 (Rel. 57, Created)
DT   25-MAR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Beet necrotic yellow vein virus gene for 26kDa protein, isolate: S110-RNA
DE   5, complete cds.
XX
KW   26kDa protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-845
RA   Miyanishi M., Tamada T.;
RT   ;
RL   Submitted (14-OCT-1998) to the EMBL/GenBank/DDBJ databases.
RL   Masaki Miyanishi, Research Institute for Bioresources, Okayama University,
RL   Laboratory of Plant Pathology; Chuou, 2-20-1, Kurashiki, Okayama, 710-0046,
RL   Japan (E-mail:mmiya@rib.okayama-u.ac.jp, Tel:81-86-434-1232,
RL   Fax:81-86-434-1249)
XX
RN   [2]
RA   Miyanishi M., Kusume T., Saito M., Tamada T.;
RT   "Evidence for three groups of sequence variants of beet necrotic yellow
RT   vein virus RNA 5";
RL   Arch. Virol. 144:879-892(1999).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .845
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="S110-RNA 5"
FT   CDS             123. .809
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR004266"
FT                   /db_xref="UniProt/TrEMBL:Q9YJF4"
FT                   /transl_table=1
FT                   /gene="P26"
FT                   /product="26kDa protein"
FT                   /protein_id="BAA33899.1"
FT                   /translation="MDIDHCMPVFDMAYSDDNHLPYYIQRSTHHVVRDVDYTGFICYPL
FT                   QVDLNDNVEVGADIYHMKIKTMRFNVDIYNNDVATKFPGWVRFIVFCTPPVSSWVNDGC
FT                   SSLFSPFVGVNSFIDPKLLKRDGHGITVLHDGIYCLCYQEHFTRSFEFNFRGPGNYTLT
FT                   NDVCWSPATNVDSIYVACVASWCGDSAFMLQSDSVSWVHKRFWQRPVLEFGQCLDDLPD
FT                   HDNDCG"
XX
SQ   Sequence 845 BP; 232 A; 116 C; 181 G; 316 T; 0 other;

 AB018600  Length: 845  March 29, 2005 13:35  Type: N  Check: 9202  ..
       1  cgttaaagta ctagttacgg tgaataaaat aaaataaaaa taaaataaat
      51  aacttaaact attaatagta atttgcaatt tgtaagttac gattataatt
     101  ataattataa ttacaatttg tgatggatat tgatcattgt atgcctgtat
     151  ttgatatggc atatagcgac gataatcacc tcccttatta catacagaga
     201  tcgactcatc atgtggttcg ggatgttgat tatactggtt ttatatgtta
     251  tcctttgcag gttgatctta atgataatgt tgaggttggt gctgatatct
     301  atcacatgaa gattaagact atgagattta atgttgatat ttataacaac
     351  gatgttgcca caaaattccc aggttgggtt aggtttattg tgttttgtac
     401  acctcctgtg tcttcttggg ttaatgacgg gtgctctagt ctgttttcac
     451  cttttgtagg tgtgaatagt tttattgatc ctaaattgtt aaaacgtgat
     501  ggtcatggga ttactgtgtt acatgatggt atttattgct tgtgctatca
     551  agaacatttt accagaagtt ttgagtttaa ctttcgtgga cctggtaatt
     601  ataccctaac taatgatgtt tgttggtccc ccgctactaa tgtagattct
     651  atatatgtgg cttgtgttgc tagttggtgt ggtgatagtg ctttcatgtt
     701  gcagtccgat agtgtgtctt gggtacacaa gagattttgg caacgacctg
     751  tgttggaatt tgggcaatgt ttggatgacc taccagatca tgataatgat
     801  tgtggatgat cgtttgtgat gtccgaagac gttaaactac ccgca