!!NA_SEQUENCE 1.0
ID   AB018603   standard; genomic RNA; VRL; 844 BP.
XX
AC   AB018603;
XX
SV   AB018603.1
XX
DT   21-OCT-1998 (Rel. 57, Created)
DT   25-MAR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Beet necrotic yellow vein virus gene for 26kDa protein, isolate: U3-RNA 5,
DE   complete cds.
XX
KW   26kDa protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-844
RA   Miyanishi M., Tamada T.;
RT   ;
RL   Submitted (14-OCT-1998) to the EMBL/GenBank/DDBJ databases.
RL   Masaki Miyanishi, Research Institute for Bioresources, Okayama University,
RL   Laboratory of Plant Pathology; Chuou, 2-20-1, Kurashiki, Okayama, 710-0046,
RL   Japan (E-mail:mmiya@rib.okayama-u.ac.jp, Tel:81-86-434-1232,
RL   Fax:81-86-434-1249)
XX
RN   [2]
RA   Miyanishi M., Kusume T., Saito M., Tamada T.;
RT   "Evidence for three groups of sequence variants of beet necrotic yellow
RT   vein virus RNA 5";
RL   Arch. Virol. 144:879-892(1999).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .844
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="U3-RNA 5"
FT   CDS             122. .808
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR004266"
FT                   /db_xref="UniProt/TrEMBL:Q9YZL0"
FT                   /transl_table=1
FT                   /gene="P26"
FT                   /product="26kDa protein"
FT                   /protein_id="BAA33902.1"
FT                   /translation="MDIDHCMPVFDMAYSDDNHLPYYIQRSTHHVVRDVDYTGFICYPL
FT                   QVDLNANVEVGADIYHMKIKTMRFNVDIYNNDVATKFPGWVRFIVFCTPPVSSWVNDGC
FT                   SGLFSPFVGVNSFIDPKLLKRDGHGITVLHDGIYCLCHQEHFTRSFEFNFRGPGNYTLT
FT                   NDVCWSPATNVDSIYVACVASWCGDSAFMLQSDSVSWVHKRFWQRPVLEFGQCLDELPD
FT                   HDNDCG"
XX
SQ   Sequence 844 BP; 226 A; 119 C; 184 G; 315 T; 0 other;

 AB018603  Length: 844  March 29, 2005 13:35  Type: N  Check: 1232  ..
       1  cgttaaagta ctagttacgg tgcataaaat aaaataaaat aaaataaata
      51  acttaaatta ttaatagtaa tttgcaattt gtaagttacg actataatta
     101  taattataat tacaatttgt gatggatatt gatcattgta tgcctgtatt
     151  tgatatggca tatagcgacg ataatcacct cccttattac atacagagat
     201  cgactcatca tgtggttcgg gatgttgatt atactggttt tatatgttat
     251  cctttgcagg ttgatcttaa tgctaatgtt gaggttggtg ctgatattta
     301  tcacatgaag attaagacta tgagatttaa tgttgatatt tataacaacg
     351  atgttgccac aaagttccca ggttgggtta ggtttattgt gttttgtaca
     401  cctcctgtgt cttcttgggt taatgacggg tgctctggtc tgttttcacc
     451  ttttgtaggt gtgaatagtt ttattgatcc taaattgtta aaacgtgatg
     501  gtcatgggat tactgtgtta catgatggta tttattgctt gtgccatcaa
     551  gaacatttta ccagaagttt tgagtttaac tttcgtggac ctggtaatta
     601  taccctaact aatgatgttt gttggtcccc cgctactaat gtagattcta
     651  tatatgtggc ttgtgttgct agttggtgtg gcgatagtgc tttcatgttg
     701  cagtccgata gtgtgtcttg ggtacacaag agattttggc aacgacctgt
     751  gttggaattt gggcaatgtt tggatgagct accagatcat gataatgatt
     801  gtggttgatc gtttgtgacg tccgaagacg ttaaactacc cgca