!!NA_SEQUENCE 1.0
ID   AB018610   standard; genomic RNA; VRL; 834 BP.
XX
AC   AB018610;
XX
SV   AB018610.1
XX
DT   21-OCT-1998 (Rel. 57, Created)
DT   25-MAR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Beet necrotic yellow vein virus gene for 26kDa protein, isolate: S42-RNA 5,
DE   complete cds.
XX
KW   26kDa protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-834
RA   Miyanishi M., Tamada T.;
RT   ;
RL   Submitted (14-OCT-1998) to the EMBL/GenBank/DDBJ databases.
RL   Masaki Miyanishi, Research Institute for Bioresources, Okayama University,
RL   Laboratory of Plant Pathology; Chuou, 2-20-1, Kurashiki, Okayama, 710-0046,
RL   Japan (E-mail:mmiya@rib.okayama-u.ac.jp, Tel:81-86-434-1232,
RL   Fax:81-86-434-1249)
XX
RN   [2]
RA   Miyanishi M., Kusume T., Saito M., Tamada T.;
RT   "Evidence for three groups of sequence variants of beet necrotic yellow
RT   vein virus RNA 5";
RL   Arch. Virol. 144:879-892(1999).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .834
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="S42-RNA 5"
FT   CDS             112. .798
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR004266"
FT                   /db_xref="UniProt/TrEMBL:Q9YZK7"
FT                   /transl_table=1
FT                   /gene="P26"
FT                   /product="26kDa protein"
FT                   /protein_id="BAA33908.1"
FT                   /translation="MDIDHCMPAFDMAYSDDDHLPYYILRSTHNVVRDVDYTGFICYPL
FT                   QVDLNDNVEVGADIYHMKIKTMRLNVDIYNNDVATNLPGWVRFIVFCTPPVSSWVNDGC
FT                   SSLFSPFVGVNSFIDPKLSKRDGHGITVLHDGIYCLCYQEHFTGSFEFNFRGPGNYTLT
FT                   NDVCWSPATNVDSIYVACVASWHGDSAFMLQSDSVSWVHKRFWQRPVLEFGQWLDDLPD
FT                   HDNDCG"
XX
SQ   Sequence 834 BP; 220 A; 122 C; 183 G; 309 T; 0 other;

 AB018610  Length: 834  March 29, 2005 13:35  Type: N  Check: 8903  ..
       1  cgttaaagta ctagttacgg tgcttaaaat taaataaata acttaaatta
      51  ttaatagtaa tttgcaattt gtaagttacg accataatta taattataat
     101  tacaatttgt gatggatatt gatcattgta tgcctgcatt tgatatggca
     151  tatagcgacg atgatcacct cccttattac atactgagat cgactcataa
     201  tgtagttcgg gatgttgatt atactggttt tatatgttat cctttgcagg
     251  ttgatcttaa tgataatgtt gaggtcggtg ctgatattta tcacatgaag
     301  attaagacta tgagacttaa tgttgacatt tataacaacg atgttgccac
     351  aaatttacca ggttgggtta ggtttattgt gttttgcaca cctcctgtgt
     401  cttcttgggt taatgacggg tgctctagtc tgttttcacc ttttgtaggt
     451  gtgaatagtt ttattgatcc taaattgtca aaacgtgatg gtcatgggat
     501  tactgtgtta cacgatggta tttattgctt gtgctatcaa gaacatttta
     551  ccggaagttt tgagtttaac tttcgtggac ctggtaatta taccctaact
     601  aatgatgttt gttggtcgcc cgctactaat gtagattcta tatatgtggc
     651  ttgtgttgct agttggcatg gtgatagtgc tttcatgttg cagtccgata
     701  gtgtgtcttg ggtacacaag agattttggc aacgacctgt gttggaattt
     751  gggcaatggt tggatgatct accagatcat gataatgatt gtggatgatc
     801  gtttgtgacg tccgaagacg ttaaactacc cgca