!!NA_SEQUENCE 1.0
ID   AB018612   standard; genomic RNA; VRL; 840 BP.
XX
AC   AB018612;
XX
SV   AB018612.1
XX
DT   21-OCT-1998 (Rel. 57, Created)
DT   25-MAR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Beet necrotic yellow vein virus gene for 26kDa protein, isolate: S44-RNA 5,
DE   complete cds.
XX
KW   26kDa protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-840
RA   Miyanishi M., Tamada T.;
RT   ;
RL   Submitted (14-OCT-1998) to the EMBL/GenBank/DDBJ databases.
RL   Masaki Miyanishi, Research Institute for Bioresources, Okayama University,
RL   Laboratory of Plant Pathology; Chuou, 2-20-1, Kurashiki, Okayama, 710-0046,
RL   Japan (E-mail:mmiya@rib.okayama-u.ac.jp, Tel:81-86-434-1232,
RL   Fax:81-86-434-1249)
XX
RN   [2]
RA   Miyanishi M., Kusume T., Saito M., Tamada T.;
RT   "Evidence for three groups of sequence variants of beet necrotic yellow
RT   vein virus RNA 5";
RL   Arch. Virol. 144:879-892(1999).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .840
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="S44-RNA 5"
FT   CDS             118. .804
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR004266"
FT                   /db_xref="UniProt/TrEMBL:Q9YZK6"
FT                   /transl_table=1
FT                   /gene="P26"
FT                   /product="26kDa protein"
FT                   /protein_id="BAA33910.1"
FT                   /translation="MDIDHCMPVFDMAYSDDNHLPYYIQRSTHHVVRDVDYTGFICYPL
FT                   QVDLNDNVEVGADIYHMKIKTMRFNVDIYNNDVATKFPGWVRFIVFCTPPVSSWVNDGC
FT                   SSLFSPFVGVNSFIDPKLLKRDGHGITVLHDGIYCLCYQEHFTRSFEFNFRGPGNYTLT
FT                   NDVCWSPATNVDSIYVACVASWCGDSAFMLQSDSVSWVHKRFWQRPVLEFGQCLDDPPD
FT                   HDNDCG"
XX
SQ   Sequence 840 BP; 226 A; 117 C; 181 G; 316 T; 0 other;

 AB018612  Length: 840  March 29, 2005 13:35  Type: N  Check: 2467  ..
       1  cgttaaagta ctagttacag tgcttaaaat aaaaataaaa taaataactt
      51  aaattattaa tagtaatttg caatttgtaa gttacgacta taattataat
     101  tataattaca atttgtgatg gatattgatc attgtatgcc tgtatttgat
     151  atggcatata gcgacgataa tcacctccct tattacatac agagatcgac
     201  tcatcatgtg gttcgggatg ttgattatac tggttttata tgttatcctt
     251  tgcaggttga tcttaatgat aatgttgagg ttggtgctga tatttatcac
     301  atgaagatta agactatgag atttaatgtt gatatttata acaacgatgt
     351  tgccacaaag ttcccaggtt gggttaggtt tattgtgttt tgtacacctc
     401  ctgtgtcttc ttgggttaat gacgggtgct ctagtctgtt ttcacctttt
     451  gtaggtgtga atagttttat tgatcctaaa ttgttaaaac gtgatggtca
     501  tgggattact gtgttacatg atggtattta ttgcttgtgc tatcaagaac
     551  attttaccag aagttttgag tttaactttc gtggacctgg taattatacc
     601  ctaactaatg atgtttgttg gtcccccgct actaatgtag attctatata
     651  tgtggcttgt gttgctagtt ggtgtggtga tagtgctttc atgttgcagt
     701  ccgatagtgt gtcttgggta cacaagagat tttggcaacg acctgtgttg
     751  gaatttgggc aatgtttgga tgatccacca gatcatgata atgattgtgg
     801  atgatcgttt gtgacgtccg aagacgttaa actacccgca