!!NA_SEQUENCE 1.0
ID   AB018615   standard; genomic RNA; VRL; 856 BP.
XX
AC   AB018615;
XX
SV   AB018615.1
XX
DT   21-OCT-1998 (Rel. 57, Created)
DT   25-MAR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Beet necrotic yellow vein virus gene for 26kDa protein, isolate: CH3-RNA 5,
DE   complete cds.
XX
KW   26kDa protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-856
RA   Miyanishi M., Tamada T.;
RT   ;
RL   Submitted (14-OCT-1998) to the EMBL/GenBank/DDBJ databases.
RL   Masaki Miyanishi, Research Institute for Bioresources, Okayama University,
RL   Laboratory of Plant Pathology; Chuou, 2-20-1, Kurashiki, Okayama, 710-0046,
RL   Japan (E-mail:mmiya@rib.okayama-u.ac.jp, Tel:81-86-434-1232,
RL   Fax:81-86-434-1249)
XX
RN   [2]
RA   Miyanishi M., Kusume T., Saito M., Tamada T.;
RT   "Evidence for three groups of sequence variants of beet necrotic yellow
RT   vein virus RNA 5";
RL   Arch. Virol. 144:879-892(1999).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .856
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="CH3-RNA 5"
FT   CDS             134. .820
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR004266"
FT                   /db_xref="UniProt/TrEMBL:Q9YJF4"
FT                   /transl_table=1
FT                   /gene="P26"
FT                   /product="26kDa protein"
FT                   /protein_id="BAA33913.1"
FT                   /translation="MDIDHCMPVFDMAYSDDNHLPYYIQRSTHHVVRDVDYTGFICYPL
FT                   QVDLNDNVEVGADIYHMKIKTMRFNVDIYNNDVATKFPGWVRFIVFCTPPVSSWVNDGC
FT                   SSLFSPFVGVNSFIDPKLLKRDGHGITVLHDGIYCLCYQEHFTRSFEFNFRGPGNYTLT
FT                   NDVCWSPATNVDSIYVACVASWCGDSAFMLQSDSVSWVHKRFWQRPVLEFGQCLDDLPD
FT                   HDNDCG"
XX
SQ   Sequence 856 BP; 240 A; 116 C; 182 G; 318 T; 0 other;

 AB018615  Length: 856  March 29, 2005 13:35  Type: N  Check: 7549  ..
       1  cgttaaagta ctagttacag tgcaaaaata aaataaaaat aaaaataaaa
      51  ataaaataaa taacttaaat tattaatagt aatttgcaat ttgtaagtta
     101  cgactataat tataattata attacaattt gtgatggata ttgatcattg
     151  tatgcctgta tttgatatgg catatagcga cgataatcac ctcccttatt
     201  acatacagag atcgactcat catgtggttc gggatgttga ttatactggt
     251  tttatatgtt atcctttgca ggttgatctt aatgataatg ttgaggttgg
     301  tgctgatatt tatcacatga agattaagac tatgagattt aatgttgata
     351  tttataacaa cgatgttgcc acaaagttcc caggttgggt taggtttatt
     401  gtgttttgta cacctcctgt gtcttcttgg gttaatgacg ggtgctctag
     451  tctgttttca ccttttgtag gtgtgaatag ttttattgat cctaaattgt
     501  taaaacgtga tggtcatggg attactgtgt tacatgatgg tatttattgc
     551  ttgtgctatc aagaacattt taccagaagt tttgagttta actttcgtgg
     601  acctggtaat tataccctaa ctaatgatgt ttgttggtcc cccgctacta
     651  atgtagattc tatatatgtg gcttgtgttg ctagttggtg tggtgatagt
     701  gctttcatgt tgcagtccga tagtgtgtct tgggtacaca agagattttg
     751  gcaacgacct gtgttggaat ttgggcaatg tttggatgat ctaccagatc
     801  atgataatga ttgtggatga tcgtttgtga cgtccgaaga cgttaaacta
     851  cccgcg