!!NA_SEQUENCE 1.0
ID   AB018619   standard; genomic RNA; VRL; 846 BP.
XX
AC   AB018619;
XX
SV   AB018619.1
XX
DT   21-OCT-1998 (Rel. 57, Created)
DT   25-MAR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Beet necrotic yellow vein virus gene for 26kDa protein, isolate: FP-RNA 5,
DE   complete cds.
XX
KW   26kDa protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-846
RA   Miyanishi M., Tamada T.;
RT   ;
RL   Submitted (14-OCT-1998) to the EMBL/GenBank/DDBJ databases.
RL   Masaki Miyanishi, Research Institute for Bioresources, Okayama University,
RL   Laboratory of Plant Pathology; Chuou, 2-20-1, Kurashiki, Okayama, 710-0046,
RL   Japan (E-mail:mmiya@rib.okayama-u.ac.jp, Tel:81-86-434-1232,
RL   Fax:81-86-434-1249)
XX
RN   [2]
RA   Miyanishi M., Kusume T., Saito M., Tamada T.;
RT   "Evidence for three groups of sequence variants of beet necrotic yellow
RT   vein virus RNA 5";
RL   Arch. Virol. 144:879-892(1999).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .846
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="FP-RNA 5"
FT   CDS             112. .810
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR004266"
FT                   /db_xref="UniProt/TrEMBL:Q9YJK8"
FT                   /transl_table=1
FT                   /gene="P26"
FT                   /product="26kDa protein"
FT                   /protein_id="BAA33917.1"
FT                   /translation="MDIDHCMPVFDMAYSDDNHLPYYIQRSTHNVVRDVDYTGFICYPL
FT                   QVDLNDNVEVGADIYHMKIKTMRLNVDIYNNDDVATNFPGWVRFIVFCTPPVSSWVNGG
FT                   CSSLFSPFVGVNSFIDPKLLKRDGHGITVLHDGIYCLRYQEFFTGSFEFNFRGPGNYTL
FT                   TNDVCWSPATSVDSIYVACVASWCGDSAFMLQSDSVAWVHKRFWQRPVLEFGQCLDDLP
FT                   DHDNNNNDCG"
XX
SQ   Sequence 846 BP; 222 A; 119 C; 189 G; 316 T; 0 other;

 AB018619  Length: 846  March 29, 2005 13:35  Type: N  Check: 8984  ..
       1  cgttattgta ctagttacgg tgcgtaaaaa taaaataaaa taaacaaatt
      51  gaattattaa cagtaatttg caatttgcaa gttgcgatca caattatatt
     101  tacaatttgt gatggatatt gatcattgta tgcctgtatt tgatatggca
     151  tatagcgacg ataatcacct tccttattac atacagagat cgactcataa
     201  tgtggttcgg gatgttgatt atactggttt tatatgttat cctttgcagg
     251  tcgatcttaa tgataatgtt gaggtcggtg ctgatattta tcacatgaag
     301  attaagacta tgagacttaa tgtcgatatt tataacaatg atgatgttgc
     351  cacaaatttt ccaggttggg ttaggtttat tgtgttttgt acacctcctg
     401  tgtcttcttg ggttaatggc gggtgctcta gtctgttttc accttttgta
     451  ggtgtgaata gttttattga ccctaaattg ttaaaacgtg atggtcatgg
     501  gattactgtg ttacatgatg gtatttattg tttgcgctat caagaatttt
     551  ttaccggaag ttttgagttc aactttcgtg gacctggtaa ttatacccta
     601  actaatgatg tttgttggtc ccccgctact agtgtggatt ctatatatgt
     651  ggcttgtgtt gctagttggt gtggtgatag tgcttttatg ttgcagtccg
     701  atagtgtggc ttgggtacac aagagatttt ggcaacgacc tgtgttggaa
     751  tttgggcaat gtttagatga tctaccagat catgataata ataataatga
     801  ttgtggatga tcgtttgtga cgtccgaaga cgttaaacta cccgca