!!NA_SEQUENCE 1.0
ID   AB018621   standard; genomic RNA; VRL; 567 BP.
XX
AC   AB018621;
XX
SV   AB018621.1
XX
DT   21-OCT-1998 (Rel. 57, Created)
DT   25-MAR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Beet necrotic yellow vein virus gene for coat protein, isolate: SH1-CP,
DE   complete cds.
XX
KW   coat protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-567
RA   Miyanishi M., Tamada T.;
RT   ;
RL   Submitted (14-OCT-1998) to the EMBL/GenBank/DDBJ databases.
RL   Masaki Miyanishi, Research Institute for Bioresources, Okayama University,
RL   Laboratory of Plant Pathology; Chuou, 2-20-1, Kurashiki, Okayama, 710-0046,
RL   Japan (E-mail:mmiya@rib.okayama-u.ac.jp, Tel:81-86-434-1232,
RL   Fax:81-86-434-1249)
XX
RN   [2]
RA   Miyanishi M., Kusume T., Saito M., Tamada T.;
RT   "Evidence for three groups of sequence variants of beet necrotic yellow
RT   vein virus RNA 5";
RL   Arch. Virol. 144:879-892(1999).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .567
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="SH1-CP"
FT   CDS             1. .567
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9W914"
FT                   /db_xref="InterPro:IPR001337"
FT                   /db_xref="UniProt/TrEMBL:Q9W914"
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="BAA33919.1"
FT                   /translation="MSSEGRYMTWKDMSHNKFMTDRWARVSDVVSVIKQSHAMDLSKAA
FT                   NLSIIKTALAGLGSGWTDNNPFVSPMTRFPQTLTMYGALVLYVNLSDPEFALIMTKVST
FT                   LTDSGLADNASANVRRDVVSGNKAESSGKTAGTNENSAYTLTVSLAGLAQALRLEELMW
FT                   TRDKFEDRLKLPWTPVQGRTSPPGQ"
XX
SQ   Sequence 567 BP; 154 A; 108 C; 140 G; 165 T; 0 other;

 AB018621  Length: 567  March 29, 2005 13:35  Type: N  Check: 4110  ..
       1  atgtcgagtg aaggtagata tatgacatgg aaggatatgt cacataataa
      51  gtttatgacc gatcgatggg cccgtgtttc ggacgtcgtg agtgttatta
     101  aacaatcgca tgctatggac ttgtccaagg ctgcgaatct atctataatt
     151  aaaactgctt tggcaggatt aggctcgggt tggactgaca ataatccttt
     201  tgtgtccccg atgacccgtt ttccacagac actaactatg tacggtgcac
     251  ttgtgttata tgttaatctg tctgacccag aatttgcgtt gataatgact
     301  aaggtaagta ctttaactga ttcagggtta gcagataacg catctgctaa
     351  tgtgcgtaga gatgtggtgt ccggaaataa agccgaatca tccggtaaaa
     401  ctgctggcac taatgagaat tctgcttata cgcttaccgt tagtcttgct
     451  ggtttggctc aagctcttag gcttgaggaa ttaatgtgga ctcgggataa
     501  gtttgaggac cggttgaaat taccatggac acctgttcaa ggcagaacca
     551  gtccacccgg acaatag