!!NA_SEQUENCE 1.0
ID   AB018626   standard; genomic RNA; VRL; 567 BP.
XX
AC   AB018626;
XX
SV   AB018626.1
XX
DT   21-OCT-1998 (Rel. 57, Created)
DT   25-MAR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Beet necrotic yellow vein virus gene for coat protein,  complete
DE   cds,isolate: CH2-CP.
XX
KW   coat protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-567
RA   Miyanishi M., Tamada T.;
RT   ;
RL   Submitted (14-OCT-1998) to the EMBL/GenBank/DDBJ databases.
RL   Masaki Miyanishi, Research Institute for Bioresources, Okayama University,
RL   Laboratory of Plant Pathology; Chuou, 2-20-1, Kurashiki, Okayama, 710-0046,
RL   Japan (E-mail:mmiya@rib.okayama-u.ac.jp, Tel:81-86-434-1232,
RL   Fax:81-86-434-1249)
XX
RN   [2]
RA   Miyanishi M., Kusume T., Saito M., Tamada T.;
RT   "Evidence for three groups of sequence variants of beet necrotic yellow
RT   vein virus RNA 5";
RL   Arch. Virol. 144:879-892(1999).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .567
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="CH2-CP"
FT   CDS             1. .567
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9YIY8"
FT                   /db_xref="InterPro:IPR001337"
FT                   /db_xref="UniProt/TrEMBL:Q9YIY8"
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="BAA33924.1"
FT                   /translation="MSSEGRYMTWKDMSHNKFMTDRWARVSDVVSVIKQSHAMDLSKAA
FT                   NLSIIKTALAGLGSGWSDNNPFVSPMTRFPQTLTMYGALVLYVNLSDPEFALIMTKVNT
FT                   LTDSGLADNASANVRRDVVSGHKAESSGKTAGTNENSAYTLTVSLAGLAQALRLEELMW
FT                   TRDKFEDRFKLPWTPVQGRTSPPGQ"
XX
SQ   Sequence 567 BP; 155 A; 104 C; 137 G; 171 T; 0 other;

 AB018626  Length: 567  March 29, 2005 13:35  Type: N  Check: 6414  ..
       1  atgtcgagtg aaggtagata tatgacatgg aaggatatgt cacataataa
      51  gtttatgacc gatcgatggg ctcgtgtttc ggacgtcgtg agtgttatta
     101  aacaatcgca tgctatggac ttgtccaagg ctgcgaatct atctataatt
     151  aaaactgctt tggcaggatt aggatcgggt tggtctgaca ataatccttt
     201  tgtgtctccg atgacccgtt ttccacagac actaactatg tatggtgcgc
     251  ttgtgttata tgttaatctg tctgacccag aatttgcgtt gataatgact
     301  aaggtaaata ctttaactga ttcagggtta gcagataatg catctgctaa
     351  tgtacgtaga gatgtggtgt ctggacataa agctgaatca tccggtaaaa
     401  ctgctggtac taatgagaac tctgcttaca cgcttactgt cagtcttgct
     451  ggtttagctc aagctcttag gcttgaagaa ttgatgtgga cccgggataa
     501  gtttgaggac cggttcaaat taccatggac acctgttcaa ggtagaacca
     551  gtccacccgg acaatag