!!NA_SEQUENCE 1.0
ID   AB018698   standard; genomic RNA; VRL; 3569 BP.
XX
AC   AB018698;
XX
SV   AB018698.1
XX
DT   29-APR-1999 (Rel. 59, Created)
DT   20-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Broad bean wilt virus 2 gene for precursor polyprotein, complete cds,
DE   isolate: IP.
XX
KW   .
XX
OS   Broad bean wilt virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Fabavirus.
XX
RN   [1]
RP   1-3569
RA   Kobayashi Y.O.;
RT   ;
RL   Submitted (15-OCT-1998) to the EMBL/GenBank/DDBJ databases.
RL   Yuki Ohdaira Kobayashi, National Agriculture Research Center, Virology
RL   Laboratory; Kan-nondai 3-1-1, Tsukuba, Ibaraki, 305-8666, Japan
RL   (E-mail:oodaira@narc.affrc.go.jp, Tel:81-298-38-8931, Fax:81-298-38-8929)
XX
RN   [2]
RA   Kobayashi Y.O., Nakano M., Kashiwazaki S., Naito T., Shiota A.,
RA   Mikoshiba Y., Kameya-Iwaki M., Honda Y.;
RT   "Sequence analysis of RNA-2 of different isolates of broad bean wilt virus
RT   confirms the existence of two distinct species";
RL   Arch. Virol. 144:1429-1438(1999).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3569
FT                   /db_xref="taxon:76875"
FT                   /mol_type="genomic RNA"
FT                   /organism="Broad bean wilt virus 2"
FT                   /isolate="IP"
FT   CDS             206. .3400
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9WAU6"
FT                   /db_xref="InterPro:IPR003181"
FT                   /db_xref="InterPro:IPR003182"
FT                   /db_xref="UniProt/TrEMBL:Q9WAU6"
FT                   /transl_table=1
FT                   /product="precursor polyprotein"
FT                   /protein_id="BAA77241.1"
FT                   /translation="MNPELVAVLDRYLSEIASSLFLGWIVNLCLVFFCSAKSCFLLWAA
FT                   FLYINYYILRFEFAYIVAPFLKTIYSNSSQYHTVDWENAYTARSKNLWEQITDYNYCFN
FT                   FPKPIVEGFVSDFSPRFTFEELVAMNEANITPIHTIPRETLLKRASDYKLAVESKKSIL
FT                   PKVQDLYEMDKWHALKSRLNRNAPSYVVTSEIAVGAMSGAGNVKLALPVVEKYTEEVAD
FT                   DRLPDKVRAKADQIMVAAIELVADGFASVNSDVTMAGALYDKRHKTIASSFKGAFASRA
FT                   SGVPSHVIYYPMHRVPSNDDPNSTLELSMVSRDSDFDEGFTLANISARTLYVRAKGPEK
FT                   VTETRHLLKAKTEDVVKAQQFASEAQVVFATPRLFPEVNLDNYNLPGPSNVQQTEAITT
FT                   NRGILFPKPKFKGNEVVLNYTGPTKVGNVSAQRPGKQEFSSNPYVGSIDDLGCLSDEDG
FT                   KDYRYGQGLMEEDVLNVQTNNFAIESATETMRLLFSGYANIPLNVTPGTKLTVAYLNEL
FT                   SKHSAVHTGLLNMLSKVPGSLKVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLG
FT                   IQHYKWNPAIEPYVEFVFKPFSCADWWNMHYLGSFKYAPVMVIQALSKWLNAPKVDAKM
FT                   SFAIYYEPSVILPKQIATLDHAPAFMFRKELGTLAFKQGERVAYSFEVNFGKPQTDGKE
FT                   VTSTFASSYCGLSQYMQSDVILDFTLMSSPMIGGTFSIAYVAGAYIEKVGNMQILDSLP
FT                   HVDFTFSSGSKSTRSVRFPKEVFGVHQALDRWDLDSARGDDVSGNFVIYQRDAVSSALE
FT                   GELTFRIAARLSGDINFVGVSAGYPTTITRIGKGKVQGRSLDPEIRKPLRYMLGQSHLT
FT                   PQDFSSVRFVMGRWKYKAGLYPGSKSDEDIHPYSLKMRLDGSKSSENFEIIHSPFVRLL
FT                   QNCAWMKGTLKFYVVARASSDYMSYRRTSQLTVSAHENSLSSNQFYSGVLTSPSGEIGF
FT                   SREVVGPVDGFASMGWNVRGSKKFYKIHVEMGNVHEYDTVMLYGQFGPNVEFAGQQKGG
FT                   HYLLEKETPTFKAFKY"
FT   mat_peptide     206. .1600
FT                   /note="putative"
FT                   /product="movement protein"
FT   mat_peptide     1601. .2806
FT                   /product="large coat protein"
FT   mat_peptide     2807. .3397
FT                   /product="small coat protein"
XX
SQ   Sequence 3569 BP; 1011 A; 648 C; 827 G; 1083 T; 0 other;

 AB018698  Length: 3569  April 26, 2005 08:32  Type: N  Check: 2985  ..
       1  tgttttaata aaatattaaa acaaacagct ttcgttccga aaaacagctt
      51  tcaaatttca aacagctttc agacactttg gaattttcag attgaacccg
     101  gaaaaaggga gtgtgattta aagcgcacca tatcatttga aaatttcgtt
     151  ttgattctag ctttccttgc taatgttatt tatgcaaata tgagtttttg
     201  ttgtaatgaa tcctgagtta gtagccgtgt tggataggta tctatctgag
     251  attgcaagca gtttattttt aggctggatt gtaaatcttt gcttagtttt
     301  cttttgttct gctaaaagtt gttttttatt gtgggccgca ttcctttaca
     351  tcaattatta tatattgaga tttgaatttg catatatcgt tgcacccttc
     401  cttaaaacga tatactcaaa tagttctcag tatcacactg ttgattggga
     451  aaacgcttac acggcacgtt ccaaaaattt gtgggaacaa ataactgatt
     501  acaactactg tttcaatttc ccaaaaccca ttgtagaggg atttgtgtca
     551  gatttttcgc cccgatttac atttgaagaa cttgtcgcca tgaatgaggc
     601  aaatattacc ccaattcaca caattccgag agaaaccttg ctcaaaagag
     651  caagtgatta taaattggct gtggagagca aaaagtccat actgcccaaa
     701  gttcaggatt tgtatgaaat ggacaaatgg catgccttga agagtaggtt
     751  gaacagaaat gcacctagct atgttgtaac ttcagagatt gcagttggag
     801  ctatgtcagg tgctggaaat gtaaaattgg cgctgcccgt ggtggaaaaa
     851  tacactgaag aggtagcaga tgacagattg cctgacaaag ttcgtgccaa
     901  agctgatcaa ataatggttg cggccattga gttggtggca gatggcttcg
     951  cctcagttaa ttctgatgtc accatggcag gtgcgcttta tgataagcgc
    1001  cacaagacaa ttgctagctc tttcaaagga gcttttgcat ccagagcaag
    1051  tggagtccct tctcatgtca tttattatcc gatgcataga gttccttcaa
    1101  atgatgaccc taattcaact ttggaacttt caatggttag tcgtgattct
    1151  gattttgatg agggtttcac gctggccaat atctcagcac gtactcttta
    1201  tgttcgtgca aaaggacctg aaaaggtaac tgaaacaagg catctcttga
    1251  aggccaagac agaggatgtg gtaaaagcgc aacaatttgc gagtgaagca
    1301  caagtcgtgt ttgccactcc tcggcttttt cctgaagtca atttggacaa
    1351  ttacaacttg cctgggccta gcaatgtgca gcagacagaa gcaattacta
    1401  ccaatagagg aattcttttc ccgaagccaa aatttaaagg aaatgaagta
    1451  gtgcttaact atacaggacc aacgaaagtt ggaaatgtta gtgcgcagag
    1501  gcctgggaag caagagttca gcagcaaccc atatgtggga agcattgatg
    1551  atcttggatg tctatcagat gaggatggca aggattatag atatggccaa
    1601  ggcttgatgg aggaggacgt tttgaacgtt caaaccaaca atttcgccat
    1651  tgagtctgct acagaaacta tgcgcttatt gttcagtggt tacgcgaaca
    1701  ttcctttgaa cgttacacct ggaactaaac ttactgtggc ttatcttaat
    1751  gagttatcca agcatagtgc tgtgcatact ggtttattga atatgcttag
    1801  caaagtccca ggttctttga aggtcaagat aaattgccag gttgctccca
    1851  catgtgggat tggattggca gtaagttatg tcgaaggcaa tgaaagtgca
    1901  aacttgggat ctagcctggg gcgtttgttg ggtattcagc attacaaatg
    1951  gaatccagct atagagccct atgtggaatt tgtctttaag cccttttcct
    2001  gcgcagattg gtggaacatg cattatttgg gatcattcaa atatgcacct
    2051  gtgatggtca ttcaagcatt atccaaatgg ttgaatgctc caaaagtgga
    2101  tgccaagatg agctttgcca tttattatga acccagtgtg attttgccca
    2151  aacaaatagc aactttggac cacgccccag cattcatgtt tcgcaaggaa
    2201  ctggggactt tggcttttaa gcaaggggaa cgcgtggcat attctttcga
    2251  agttaatttc ggcaaacctc agacagacgg aaaggaagtg acatcaactt
    2301  ttgcctcatc ttactgtggt ttgagtcagt acatgcaatc tgatgtgatt
    2351  ttggatttca ctcttatgag cagtcctatg attggaggca ccttttcaat
    2401  tgcatatgtt gcaggtgcat atattgagaa agttgggaac atgcaaattc
    2451  ttgactcatt gccccatgtt gatttcacat tttcatcagg ttccaagagc
    2501  acgcgttctg tgcgctttcc gaaagaagtt tttggagtgc atcaggcatt
    2551  ggataggtgg gatttagact cagcaagggg agatgatgtc tcaggcaact
    2601  ttgtgattta ccagagagat gcagtctcta gtgctcttga aggggaattg
    2651  acgttccgaa ttgctgctcg tttgtctgga gacatcaatt ttgttggtgt
    2701  tagtgcaggc tatccaacaa caattacgcg aattggcaaa ggtaaggtgc
    2751  aaggaagatc gcttgatcct gaaatcagaa agcccttaag gtacatgctt
    2801  ggacagtccc atttaacacc acaggatttt agttcagtgc gctttgtaat
    2851  gggtcgctgg aaatacaaag ctggtttgta cccagggagt aaatcagatg
    2901  aagacatcca cccatattcc ctcaaaatgc gccttgatgg ctcaaagagc
    2951  agcgagaatt ttgaaattat tcattctcct tttgttcggt tgttgcaaaa
    3001  ttgtgcatgg atgaaaggaa ctttgaagtt ctatgttgtg gcacgagcta
    3051  gctctgatta catgagttac agaaggacct ctcaattgac agtttcagct
    3101  catgagaata gtcttagctc taaccaattc tacagtggag ttttgacaag
    3151  ccctagtggt gaaataggtt tttccagaga ggttgtaggc ccagtggatg
    3201  gcttcgcatc tatgggctgg aacgtgcgtg ggagtaaaaa gttttacaaa
    3251  attcatgttg aaatggggaa tgttcacgag tatgacactg tgatgttgta
    3301  tgggcaattt ggtccgaatg tggaatttgc tggtcaacag aaaggtggcc
    3351  attatttgct ggagaaggaa actccgacat ttaaggcatt caaatattga
    3401  taagcaagtt tgttcttttt gtgtgtgtgc tcaaataaaa ggcgtaggtc
    3451  actagcctcc cattaatatg ggttccatga cctgttgagt ttagaaaatt
    3501  actatttatt aaacacatgt gtgttgtgtt gggttaaagc tacctttgca
    3551  tgagctttaa tagttttcc