!!NA_SEQUENCE 1.0
ID   AB023484   standard; RNA; VRL; 5953 BP.
XX
AC   AB023484;
XX
SV   AB023484.1
XX
DT   03-APR-2001 (Rel. 67, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 3)
XX
DE   Broad bean wilt virus 2 gene for polyprotein, complete cds.
XX
KW   polyprotein.
XX
OS   Broad bean wilt virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Fabavirus.
XX
RN   [1]
RP   1-5953
RA   Kobayashi Y.O.;
RT   ;
RL   Submitted (08-FEB-1999) to the EMBL/GenBank/DDBJ databases.
RL   Yuki Ohdaira Kobayashi, National Agriculture Research Center, Virology
RL   Laboratory; Kan-nondai 3-1-1, Tsukuba, Ibaraki 305-8666, Japan
RL   (E-mail:oodaira@narc.affrc.go.jp, Tel:81-298-38-8931, Fax:81-298-38-8929)
XX
RN   [2]
RA   Kobayashi Y.O.;
RT   "Broad bean wilt virus 2 gene for precursor polyprotein, putative protease
RT   and RNA polymerase";
RL   Unpublished.
XX
DR   GOA; Q998P7.
DR   SPTREMBL; Q998P7; Q998P7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5953
FT                   /db_xref="taxon:76875"
FT                   /mol_type="genomic RNA"
FT                   /organism="Broad bean wilt virus 2"
FT                   /isolate="IP"
FT   CDS             230. .5839
FT                   /codon_start=1
FT                   /db_xref="GOA:Q998P7"
FT                   /db_xref="SPTREMBL:Q998P7"
FT                   /transl_table=1
FT                   /product="polyprotein"
FT                   /protein_id="BAB40439.1"
FT                   /translation="MDFSMMQMAVGFLKTSMGLQSIKDIVGKACVAEKDKTLLHIHLCF
FT                   FHANEMARDFNEGVDMGQIQSSAAIKYRAAVLKRHVVMNVETGRYDRARMMQYNNETCV
FT                   NWFSCEIVEEKAKKVLDEEEAQEDNIVDDFLKNCAFSEEVGQTSEEGAGHYAFGQGLYE
FT                   YATRISDAIVAVISGSIKKSIDDFLDKVYAVMAQVFAAWMPRIRAAFQWFENIKEVIKR
FT                   WANSMHEKINFILVGMEDCLYMGAGLVAATCIVTLLEKFMIAIGILTKPCGAATLFLTT
FT                   AMAAISATYVCGKALEKSAMLTNLLLFVTTNCRVVLDTLFNHELGRQEQEMSQNDEKAP
FT                   TGFGQFGVSTMLQDVANLVSTWSTSSVTEIGKTFGAISQIKNGILALRDMVYFVFEKLS
FT                   ELAHRVLGFESQVLADLSVLLGENVADWLCECDCMVAYMLEFNSRNREIFDRLSQLIEK
FT                   GRMIRTGVLRSSHRGSSQVMSLVTKALEKLIELHNSVVMAGSNTTRKSPFMVFFTGASG
FT                   TGKTSVVQRVAINWLQEEQLGTSEIYARNGQDPFWSGYKRHAVVTYDDFGAVPGTTSNE
FT                   AEIINVISRNPYATVMAGLAEKGMYFDSRLVLASSNFLAANPESGVHDSEAYERRRHAV
FT                   VRVSLKPGVPYNANDPCANQTYTLLESKTPFNEIQVFETYAELWSFLYTRFKEHEEQEE
FT                   LYLKSLPILDSDKKEALEGLVGLTVIATSFAPKAVMQFGAEKFPGYHFLISDGEYCYFW
FT                   HGDGSVEFVSVERMKLGKQDIIQLKQQGLSTAMMYKDLAKAFPTLNSLAVLYAKNIVVK
FT                   RWIGADLEPTKSCEDVYMREQIGNLPKWQRAYLHVLSKYLTVQSPRGWFMECLEEAKRN
FT                   LRATYLWEYKQWPLPLKLALGSLIAIMAGGAIWYSLQSLWCVSGDASFIAGAATVFSVS
FT                   SFAGQSDVPNRDNSERSFRNRRIRARTWQGQSSCFGDSALWIAETCMATLTFSNVRTQV
FT                   CLAPGRGFFGVNHCLAAIPAGVMVKLDSSIGITYFVWEKEKLTQFEGNEIALYMTSTMP
FT                   KTVDSLLSRIHFDAETLPKTFNAVFFSYKYDPVIQQMVPELGSVTCKIHNKAFTLAHGE
FT                   YRREIPQSLTYEASTVAGDCGSLILAEIEGKFKLVGMHVAFNGKEGSASFMPYHALLDQ
FT                   KVGQGDFVLKYQEWAEPKILGPGCRAMGLIDPEHALAASGKTTFVETPEEWHLNYPSDK
FT                   LPSVLARGDPRLAGTVHADYDPFAAGMSKYAKEAGPFDASSLKQVCLGITEVWEDASAD
FT                   FPMDEVDLDTAINGLENVEFFDALVLGTSEGFPYRLDRGPGEKGKSRYVSGESGNFKIT
FT                   DEGVLSDINWFEETSKTQVPDLYCIECVKDERLPIRKVLHEPKSRLFTVLPMSYNIAIR
FT                   KKFLNFVRFFMKRRDVLPAQVGVNPYSREWTRIANKLLSKGNNILCCDYSRFDGFLPKC
FT                   VMNEIGDMIARVMRANDESKTQIKNLMLACTSRYAMCNRILYRVENGIPSGFPLTVIVN
FT                   SILNEILVKYAYWHCFVDNPIVQSNFDAHVSMVVYGDDNLISVSDAISSKFDGNFLVKF
FT                   MEGLGIKVTDGIDKTKIGIEFRRLENCDFLKRSFKLNPDGTWRSPMSKESLWPQLHYVK
FT                   AKKLEMAEAYINNCNNILRELWLHDVIEAKEFRNRVLRSLKWIGHEQLLNMQQLAVFHS
FT                   EQMNGISDFLSTCVTVDSISLMDPLVPGLLPVKTCEVIPRIFVAAEKHFEGNFEDFFTV
FT                   SITTSRKFKEDKGFVLLFPYGAGRGGLPTTQFMKENVVRKGCSIQKKFRQAYERGEKIL
FT                   FISQSSVVPAYVFAVMLLHSIGAISRLTSNKALTQAMHTCKKLEYLPKEYEDFF"
XX
SQ   Sequence 5953 BP; 1690 A; 1013 C; 1526 G; 1724 T; 0 other;

 AB023484  Length: 5953  July 15, 2003 09:17  Type: N  Check: 7099  ..
       1  tgttttaata aaatattaaa acaaacagct ttcgttccga aaacagcttt
      51  cagttactaa acagctttcg tttcgattaa acagccttca aacaaacagc
     101  tttcatttca tttagttgtt cttggcttgt gtggcttcgg aaagaacccg
     151  gaaaaaggga gtgtgattaa aagcgcacca tatatttcga agatcatttt
     201  gaatttcatt ttgctacctt aattttaaga tggatttcag catgatgcaa
     251  atggccgtgg gttttctcaa gacttcaatg ggtttacaat ccattaagga
     301  cattgttgga aaagcatgtg tggcggaaaa ggacaaaacc ttgctccaca
     351  ttcatttatg ctttttccat gccaatgaga tggctcggga ttttaatgaa
     401  ggtgtggata tggggcagat acaaagttct gctgcaatca aataccgagc
     451  tgcagtgtta aagcgccatg ttgttatgaa tgtggagacg ggaagatacg
     501  atcgtgcacg catgatgcag tataacaatg aaacatgcgt taactggttc
     551  tcgtgcgaga tcgttgaaga gaaggctaaa aaagtgcttg atgaagagga
     601  ggcgcaagag gacaacattg ttgatgattt tcttaagaac tgtgcgttct
     651  ctgaggaggt tggtcagacc tcagaagaag gtgctgggca ctatgccttt
     701  ggccaggggt tgtatgagta tgccactcgt attagtgatg caatagtggc
     751  agtgatctca ggctctatca aaaagagtat agatgatttt ctggacaaag
     801  tatatgcagt tatggcgcag gtctttgcgg cttggatgcc tagaattaga
     851  gctgcatttc aatggtttga aaacattaaa gaagtcatta agagatgggc
     901  caattcgatg catgaaaaaa tcaatttcat tttagttggc atggaagatt
     951  gtttgtacat gggtgctgga cttgtggcgg ccacttgcat tgtcacactg
    1001  cttgagaaat tcatgatagc tatcggaatt ttaaccaagc cttgtggggc
    1051  ggcgactctt ttcttaacaa ctgcaatggc ggctatttca gccacatatg
    1101  tgtgtggaaa agctttggaa aagtcagcta tgctcacaaa tttgttactt
    1151  tttgtgacta ccaactgccg agttgtgttg gatacgcttt tcaatcacga
    1201  attgggaagg caggagcaag agatgagcca aaatgatgag aaagccccga
    1251  caggttttgg tcagtttgga gtttcaacaa tgctacaaga cgtagccaat
    1301  ttagtttcga cgtggtcaac aagctcggtc acggaaattg ggaaaacatt
    1351  tggagccatt tcacaaatta aaaatggaat tttggcttta agagatatgg
    1401  tgtactttgt gtttgaaaaa ttgagtgaat tggctcacag agtgcttggg
    1451  tttgaatctc aagtattggc tgatttgtca gttttgcttg gagagaatgt
    1501  ggcagattgg ttatgtgaat gcgattgcat ggtggcttac atgcttgagt
    1551  ttaactccag aaatagagag atttttgata gattgtctca gctaatagag
    1601  aaaggcagaa tgataaggac aggagttttg cgctcaagtc atcgtgggtc
    1651  gtcacaggtt atgtcgcttg ttactaaggc tttagagaag ttgatagagt
    1701  tgcataactc agttgtgatg gcaggttcaa acacaactag aaagtctccc
    1751  tttatggttt ttttcacagg tgcctctggc acagggaaaa cttcagttgt
    1801  tcaaagagtt gccataaatt ggctgcagga agaacagctt gggacgagtg
    1851  aaatatacgc tcgcaatggg caggatcctt tttggtctgg ttacaaaaga
    1901  catgcggttg tcacgtatga tgattttggg gccgttccag gtacaacttc
    1951  gaatgaagct gaaattatca acgtcatttc aagaaaccca tatgcaacag
    2001  tgatggcagg cttggcggaa aaaggaatgt atttcgattc aagattggtt
    2051  ttggctagca gcaattttct tgctgccaac ccagagtcag gagttcatga
    2101  ttcagaggcg tatgagagac gaaggcacgc agtggtaaga gtttcattga
    2151  aaccaggagt tccttacaat gccaatgatc cgtgcgccaa tcaaacttac
    2201  accttgttag agtctaaaac gcctttcaat gaaattcaag tctttgagac
    2251  atatgcggaa ctctggtctt ttttgtacac aaggtttaag gagcatgagg
    2301  agcaagagga gttgtaccta aagtccttgc caatattgga ttcggacaaa
    2351  aaggaagctc tggagggctt agtgggtctc acggttatag ccacttcatt
    2401  tgctccaaag gcagttatgc aatttggagc agagaagttt ccaggatacc
    2451  actttctcat ttcggatggt gaatattgct atttttggca tggagatggg
    2501  tcggtggagt ttgttagtgt ggaacggatg aaattgggca agcaagatat
    2551  aattcagttg aagcagcaag gattgtccac ggctatgatg tataaggatc
    2601  tagctaaggc ttttcccact ttgaattctt tagctgtgtt gtatgcaaaa
    2651  aatattgtgg taaagcgctg gattggtgca gatttggagc ccacaaagag
    2701  ctgtgaagat gtgtacatgc gagagcaaat aggcaatttg cccaaatggc
    2751  aaagggcata tttgcacgtg cttagcaagt atttgacagt ccaaagcccc
    2801  cgaggatggt ttatggagtg cttagaagag gcaaagagga atttgcgggc
    2851  aacatacttg tgggaataca agcaatggcc attgcctttg aaattggcat
    2901  tgggctcatt aattgccatc atggcaggtg gggctatttg gtactcacta
    2951  cagtctttat ggtgtgtgtc tggggacgct tcttttatag cgggagcagc
    3001  aacggttttt tctgtttctt cttttgctgg gcaaagtgat gtgcctaacc
    3051  gggacaattc agaaaggtca tttagaaaca ggaggatccg tgctagaaca
    3101  tggcaaggcc agagttcgtg ctttggagac tcggcacttt ggatcgcgga
    3151  aacttgtatg gcaacattga ccttttcaaa tgtgagaaca caagtgtgct
    3201  tggcgccagg aagaggtttc tttggagtga accattgcct tgctgctatt
    3251  cccgcaggtg tgatggtcaa gctggattcg agcataggaa taacttattt
    3301  tgtgtgggag aaggaaaaac tgacacagtt tgagggcaat gaaatagcat
    3351  tgtatatgac gagcacaatg cccaaaaccg tggattctct tttgagtaga
    3401  attcattttg atgctgagac tctacccaaa acttttaatg cagttttctt
    3451  ttcctacaag tatgatccag taatccagca aatggtgcct gagctgggaa
    3501  gcgtcacgtg caagattcac aacaaagctt tcacattggc acatggagag
    3551  tataggcggg aaattcccca gagccttacg tatgaggcga gcactgtggc
    3601  tggagattgt ggctctttaa tattggcgga aatcgaaggg aaattcaagc
    3651  ttgtgggtat gcatgtggca tttaatggca aggaaggaag tgcaagtttt
    3701  atgccgtacc atgctctttt ggatcaaaaa gtgggtcaag gagattttgt
    3751  gttgaagtac caagaatggg ctgagccaaa gattttgggt ccgggttgca
    3801  gggcaatggg actcatagat ccagaacatg ctctggcagc tagcgggaag
    3851  acaacatttg ttgaaacccc agaggagtgg catttgaatt acccaagcga
    3901  caaacttcct agtgttttgg caaggggtga tcctagattg gcaggcacag
    3951  ttcatgctga ttacgatcca tttgccgcag gtatgagcaa atacgcaaaa
    4001  gaggcaggac cctttgatgc tagcagcttg aaacaggtgt gtttgggaat
    4051  aaccgaagta tgggaagatg cttctgctga ttttccaatg gatgaagttg
    4101  atttggatac tgctatcaat ggcttggaaa atgtcgaatt ttttgatgcc
    4151  ttggttttag gaacttctga ggggtttcct tatcgcctag atcgtggtcc
    4201  tggtgagaaa ggaaagagca gatatgtgtc tggtgagagt ggaaatttta
    4251  aaatcactga tgaaggcgtg ctctcggaca ttaattggtt cgaggagaca
    4301  agtaagacac aggtgcctga tctttattgc attgaatgcg tcaaggatga
    4351  acgcttgcca attaggaaag tgctgcatga gcccaaaagt cggttgttca
    4401  ctgtgcttcc aatgtcctac aacatagcca ttaggaagaa gtttttgaac
    4451  tttgtcagat ttttcatgaa aaggagggat gttttaccag ctcaggttgg
    4501  tgtcaatccc tattctcggg aatggactcg aatagccaat aagttgttga
    4551  gcaaaggtaa caacattttg tgttgtgatt acagcaggtt tgacggcttt
    4601  ttgcccaagt gtgtcatgaa tgagattggg gatatgatag ccagggttat
    4651  gcgggcaaat gatgagtcca aaactcaaat caagaacctc atgcttgcat
    4701  gcaccagtcg gtatgccatg tgcaaccgaa ttttgtacag agttgaaaat
    4751  ggtattcctt ctggctttcc actcactgtc attgtgaatt ccatcctgaa
    4801  tgagatcttg gttaaatatg catattggca ttgctttgtg gacaacccaa
    4851  ttgttcagag taattttgat gcgcatgttt ccatggtggt atacggtgat
    4901  gacaatttaa tatcagtgtc ggatgcaata agctcaaagt ttgacggaaa
    4951  tttccttgtg aaattcatgg aaggacttgg aattaaggtg actgatggaa
    5001  ttgacaaaac aaagattgga atagagtttc gtcgcctgga gaattgtgat
    5051  ttcctgaaac gctctttcaa attgaatcca gatggcacat ggcgcagccc
    5101  tatgtctaag gagagcttgt ggccacagct gcactatgtg aaggcaaaga
    5151  aattggaaat ggctgaggcg tacataaaca attgcaataa catcttgcgc
    5201  gagctgtggt tgcatgatgt aatagaggcc aaggaattcc gcaatagagt
    5251  gctgagaagt ttgaaatgga ttggccatga gcaattactc aacatgcaac
    5301  aattggcagt atttcatagt gagcaaatga atggaataag cgattttcta
    5351  tccacttgtg tcacagtcga tagcatttca ttaatggacc ccctggttcc
    5401  aggtttgcta ccagtcaaga cttgtgaagt gattcctcga atctttgtgg
    5451  cggcggaaaa acactttgaa ggaaattttg aggatttctt tacagtatcc
    5501  ataaccacaa gtcgcaaatt caaggaggat aagggttttg ttcttctgtt
    5551  cccatatgga gcaggcagag gtggattgcc gacgacacaa ttcatgaaag
    5601  aaaatgtggt aagaaaaggg tgttccatac agaagaaatt taggcaggca
    5651  tatgagagag gagagaaaat tttgtttatt tcgcagagct cagtggttcc
    5701  agcttacgtg tttgctgtta tgctgcttca ttcaattggg gcaatttcca
    5751  ggctgacaag caataaagca ctcacacaag caatgcatac ttgcaagaaa
    5801  ctggagtatt tgcctaaaga gtatgaagat ttcttttgaa ttcaatttca
    5851  ttttgttgtg tgtgtatttt agttattaat cactacttat attgtataat
    5901  atgtattatg cagggttgaa atgcctttcc cgagtaaatt tcagtagtga
    5951  ggg