!!NA_SEQUENCE 1.0
ID   AB032403   standard; RNA; VRL; 3593 BP.
XX
AC   AB032403;
XX
SV   AB032403.1
XX
DT   02-MAY-2000 (Rel. 63, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 4)
XX
DE   Broad bean wilt virus 2 genomic RNA segment 2, complete sequence.
XX
KW   119kDa protein precursor.
XX
OS   Broad bean wilt virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Fabavirus.
XX
RN   [1]
RP   1-3593
RA   Kuroda T., Suzuki K.;
RT   ;
RL   Submitted (13-SEP-1999) to the EMBL/GenBank/DDBJ databases.
RL   Kazumi Suzuki, Iwate Biotechnology Research Center, Genetic Engineering 1st
RL   Research Department; Narita 22-174-4, Kitakami, Iwate 024-0003, Japan
RL   (E-mail:kasuzuki@sv02.ibrc.pref.iwate.jp, Tel:+81-197-682911,
RL   Fax:+81-197-683881)
XX
RN   [2]
RA   Kuroda T., Okumura A., Takeda I., Miura Y., Suzuki K.;
RT   "Nucleotide sequence and synthesis of infectious RNA from cloned cDNA of
RT   broad bean wilt virus 2 RNA 2";
RL   Arch. Virol. 145:787-793(2000).
XX
DR   GOA; Q9IR41.
DR   SPTREMBL; Q9IR41; Q9IR41.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3593
FT                   /db_xref="taxon:76875"
FT                   /mol_type="genomic RNA"
FT                   /organism="Broad bean wilt virus 2"
FT                   /isolate="IA isolate"
FT                   /segment="2"
FT   CDS             223. .3417
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9IR41"
FT                   /db_xref="SPTREMBL:Q9IR41"
FT                   /transl_table=1
FT                   /product="119kDa protein precursor"
FT                   /protein_id="BAA95166.1"
FT                   /translation="MRPELVAALDRYFTEIISCFFLGWFINFLLVWLNSARSAFLLWSV
FT                   FLYVSYYILRIEFAYVVAPFLKTIYTNSSQYHVVDWENAYTALPKGLWEQITDHNYCSN
FT                   SPPPTVDGFVSIFSPRFTLKELEIMNEANITPVHTIPKDTLLKRASDYKLAVESKKSIL
FT                   PKVQDLYEMDKWHTLKSKLSKNAPSYVTTSEIVVGAMSGAGNTKLAIPIVEKYTEEVAD
FT                   DSSPDRVRAKADQIMVAAIELVADGFASVNSDVTMAGALYDKRHKTIASSFKGAFASRA
FT                   SGVPSHVIYFPMHRVPSSDDPNTTLELSMVSRDSDFDEGYTLANVSARTLYVRAKGPEK
FT                   VTETRHLLKAKTEDVVKARQFASEAQVVFATPRLFPEVNLDNYNLPGPSNVQQTEAITT
FT                   DRGILFPKPKFKGNEVVLNYTGSAKIIGHDSQRFEKKDVVGEQFVRSVEDLGCLSDEDG
FT                   KDYRYGQGLMEEDVLNVQTNNFAIESATETMRLLFSGYASIPLNVIPGTKITVAYLNEL
FT                   SKHSAVHTGLLNMLCKIPGSLKIKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLG
FT                   IQHYKWNPAIEPYVEFVFKPFSCADWWNMHYLGSFKYAPVVVIQTLSKWLNAPKVDARI
FT                   SFAIYYEPTITLPKQIATLEHAPAFMFRKELGTLAFKQGERVAYSFEVNFGKPQTDGKE
FT                   VTSTFASAYCGLSQYMQSDVILDFTLMSSPMIGGTFSIAYVAGAYIEKVGNMQILDSLP
FT                   HIDFTFSSGSKSTRSVRFPKEVFGVYQALDRWDLDSARGDDVSGNFVLYQRDAVSSALE
FT                   GELTFRIAARLSGDINFTGVSAGYPTTITRIGKGKTIGRSLDPEIRKPLRYMLGQAHAT
FT                   PKDFNSVRFVMGHWKYKAGLYPGSKSDEDIHPFSLKMRLDGSKSSENFEIIHSPFVRLL
FT                   QNCAWMRGTLKLYIVARASSDYMSYRRTSQLTVSAHENSLSSNQFYSGVLTSPSGELSF
FT                   SREVVGPVDGFASMGWNVRGNKKFYKIHVEMGNVHEYDSVVLYGQFGTDVEFAGQQKGG
FT                   HYLLEKETPIFKTIKY"
XX
SQ   Sequence 3593 BP; 1018 A; 667 C; 854 G; 1054 T; 0 other;

  AB032403  Length: 3593  July 15, 2003 09:22  Type: N  Check: 860  ..
       1  tgttttaata aaatattaaa acaaacagct ttcgttccga gaaaacagct
      51  ttcagttaca aaacagcttt cagttacata acagctttca gacactttga
     101  agtttcaaat tgaacccgga aaaagggagt gtgattcaaa gcgcaccata
     151  tattttgaaa acttcgtttc ttagttttgt tagtgcatta ccattcaaaa
     201  tcttgatttt gaatgtgttg taatgcgtcc tgaacttgtt gcagcgttag
     251  atagatactt tacagaaatc ataagttgtt tctttttggg ttggtttata
     301  aactttttgc tcgtttggct taattcagca agaagtgctt tcttgttgtg
     351  gtcagttttc ttgtacgttt catattacat attgagaatc gaatttgcat
     401  atgtcgttgc gcccttctta aaaacgatat acacaaatag ttctcaatac
     451  cacgttgtag actgggagaa cgcgtacaca gccttaccta aaggactgtg
     501  ggagcaaatt actgatcaca attattgttc taactctcct ccccctactg
     551  tcgacggttt tgtgtcgatt ttttcgccgc gatttacact caaagaactt
     601  gaaatcatga atgaagcgaa tattactccg gtacacacga ttccaaagga
     651  cacattgctt aagagagcaa gtgattacaa gctggctgtg gagagcaaga
     701  agtccatctt gcctaaagtg caagacttat acgagatgga caaatggcac
     751  actttgaaaa gcaagttgag taagaatgct cctagctacg tcacgacttc
     801  agagatagtg gttggtgcga tgtcaggagc aggaaatacg aaattagcaa
     851  taccgattgt tgagaagtac accgaggagg tagcagatga cagttcgcct
     901  gatagagttc gtgctaaagc tgatcagata atggttgcag ctattgagtt
     951  ggtggcagat ggttttgcct cagtcaattc ggatgtgact atggctggag
    1001  cactctatga taagcgtcac aagactattg cgagttcctt caagggtgcc
    1051  tttgcatcta gagcgagcgg tgttccttcg catgtcattt actttcctat
    1101  gcatagagtt ccctcgagtg atgatccaaa cacaactctg gagctttcaa
    1151  tggtgagccg agactcagat tttgatgaag gttacacgct ggccaatgtt
    1201  tcagctcgca ctctttacgt tcgcgcaaaa ggacctgaaa aggtcacaga
    1251  gacaaggcat cttttgaaag ccaagactga ggacgtcgtg aaagcgcgcc
    1301  agtttgcaag tgaggcacaa gttgtatttg ccacgcctcg gttgtttccc
    1351  gaagtgaatt tggataatta caatttgcct ggacctagca atgtgcagca
    1401  gacagaggcc atcaccactg atagaggaat attgtttccg aagccaaaat
    1451  ttaaaggaaa tgaggtggtg ctcaattaca caggatcggc aaagattata
    1501  ggtcatgact cacagagatt tgagaagaaa gatgttgttg gtgagcaatt
    1551  cgttagaagc gttgaagatc taggatgttt gtctgatgag gatggcaagg
    1601  actataggta tggccaaggc ttaatggagg aagatgtgct gaatgtgcag
    1651  acgaacaatt ttgctataga atcagccacg gaaaccatgc gcttgttatt
    1701  tagtgggtac gcaagtatcc ctttgaacgt tataccgggg accaaaatca
    1751  cggtggccta cttgaacgaa ttatctaaac atagtgcagt gcatactggc
    1801  ttattgaata tgttgtgcaa aatcccaggc tctttgaaga ttaaaatcaa
    1851  ttgccaggtg gccccaacat gcggaattgg attggcagtt agttatgtcg
    1901  agggaaatga aagtgcaaat ttgggttcta gcctgggacg cttgttaggc
    1951  attcagcact acaagtggaa cccagctata gagccgtatg tggaatttgt
    2001  tttcaagccc ttttcctgtg cagactggtg gaacatgcat tatttagggt
    2051  ctttcaaata tgctcctgtg gtggtcatac agacactgtc caagtggctg
    2101  aacgctccga aggtggatgc cagaattagt tttgcgatat actatgagcc
    2151  caccatcaca ttgcccaagc agatagccac cttagagcac gccccagcat
    2201  ttatgtttcg caaggagtta gggacattgg ctttcaagca aggggagcgc
    2251  gtagcttact catttgaagt caattttggc aaaccacaaa ctgacggaaa
    2301  ggaagtaact tcaacttttg catcagctta ttgcggcctc agccaatata
    2351  tgcaatcaga tgtcattttg gattttactc tcatgagtag tcctatgatt
    2401  ggaggaactt tctcgattgc atatgtcgca ggagcttaca ttgaaaaggt
    2451  tggaaacatg caaattttag actccttgcc ccatatcgat ttcacatttt
    2501  cttcaggatc taagagcacg cgttctgtgc gatttcccaa ggaggtcttt
    2551  ggggtgtatc aagcacttga taggtgggat ttggattcgg ctagaggaga
    2601  tgatgtctca ggtaattttg tgctttatca aagagatgcg gtttcgagcg
    2651  ctttggaagg agaacttact ttcagaatag ctgcccgctt gtctggagat
    2701  atcaacttca caggtgtgag tgcaggttac ccaacgacaa ttacgcgcat
    2751  agggaaaggt aaaaccatag gaaggtcact tgatcctgag attaggaagc
    2801  ctctgaggta catgcttggt caagcacatg caacacccaa agattttaac
    2851  tcagtgcgtt tcgtgatggg ccactggaaa tacaaagcag gtttgtatcc
    2901  tggaagcaag tcagatgagg acattcatcc tttctccttg aaaatgcgtc
    2951  ttgatggttc taagagcagt gagaactttg aaatcataca ttctcctttc
    3001  gtgcgtctat tgcagaattg tgcatggatg agaggtactt tgaaattgta
    3051  catcgtggcc cgtgctagtt ctgactatat gagttacaga aggacatcac
    3101  aattaactgt ctcggcacac gagaacagtc tcagttccaa ccaattttat
    3151  agcggagtct tgacgagccc tagtggtgaa ttgagctttt ctagagaagt
    3201  ggttggtccg gtggatggct ttgcttccat gggctggaat gtgcgtggta
    3251  acaagaagtt ttataaaatt catgtggaga tggggaatgt tcatgagtac
    3301  gattctgtag tgttgtatgg acaatttggc actgatgtcg aatttgctgg
    3351  ccaacaaaag ggtggacatt atttattgga aaaagaaact cctattttca
    3401  aaacaattaa gtattaataa cgtaagaagt tatttggtgt ttgaatttga
    3451  ataaaaaggc gtaggtcact agcctcccat taaaatgggt tccatgacct
    3501  ttgtgtgatg tgtaatattt actactctta aaacacatgt gtattgtgtt
    3551  aggttaaagc atcctttata tgtataagct ttagtagtat ttt