ID   AB050782; SV 2; linear; genomic RNA; STD; VRL; 5956 BP.
XX
AC   AB050782;
XX
DT   10-JAN-2002 (Rel. 70, Created)
DT   30-JAN-2009 (Rel. 99, Last updated, Version 5)
XX
DE   Patchouli mild mosaic virus RNA1 for polyprotein, complete cds.
XX
KW   .
XX
OS   Patchouli mild mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales;
OC   Comoviridae; Fabavirus.
XX
RN   [1]
RP   1-5956
RA   Onobori Y., Ikegami M., Natsuaki T., Sugimura Y.;
RT   ;
RL   Submitted (03-NOV-2000) to the EMBL/GenBank/DDBJ databases.
RL   Contact:Masato Ikegami Tokyo University of Agriculture, Department of
RL   Bioscience, Faculty of Applied Bioscience; 1-1-1 Sakuragaoka, Setagaya-ku,
RL   Tokyo 156-8502, Japan URL    :www.nodai.ac.jp/app/bios/
XX
RN   [2]
RA   Onobori Y., Ikegami M., Natsuaki T., Sugimura Y.;
RT   "Complete nucleotide sequence and genome organization of patchouli mild
RT   mosaic virus RNA1";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5956
FT                   /organism="Patchouli mild mosaic virus"
FT                   /segment="1"
FT                   /host="Pogostemon cablin Benth."
FT                   /lab_host="Chenopodium quinoa Willd."
FT                   /isolate="Philippines"
FT                   /mol_type="genomic RNA"
FT                   /country="Philippines"
FT                   /db_xref="taxon:73149"
FT   CDS             234. .5846
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="polyprotein"
FT                   /db_xref="GOA:Q8V978"
FT                   /db_xref="InterPro:IPR000199"
FT                   /db_xref="InterPro:IPR000605"
FT                   /db_xref="InterPro:IPR001205"
FT                   /db_xref="InterPro:IPR004004"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR014759"
FT                   /db_xref="UniProtKB/TrEMBL:Q8V978"
FT                   /protein_id="BAB83045.1"
FT                   /translation="MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKVDEKDKTLLHIHLCF
FT                   FHANEMARDLNEGMDVSQIHSSSAIKYRAAIVTRHVKMNVETGRYDRKRMVEYNNEACI
FT                   NWFSCEFMEEKGENQELLVGEGRVEEIVDEFLANCNVSERNDQVSTVRNANYAFGQGLY
FT                   EYATRVSDAIVAVISGSIKKGIDEFLDKVYTAMNQIFAAWMPKIRAAFQWFENIKEVVK
FT                   KWVNTMHEKINCILVGMEDCLYMGAGLVAATCIVTLLEKFMVAIGILTKPCGAATLFLT
FT                   AAMAAISAAYVCSKAVEKSVMLSNLLHFVTSNCQIVLSALFNHDATKKELTANQDGSEV
FT                   PIGLGQFGVSTMLQDVANLMSTWSTNSVTEIGRTFGAISQIKNGILALKDMIYFVFEKL
FT                   SDLAHKVLGFESQVLADLTILLGENVADWLSECDCMVSYMLEFNSRNREIFDRLSQLIE
FT                   KGRLICTGVLRTGHRGSSQVMALVTKALEKLIELHNSVVMSGSNTTRKSPFMVFFTGAS
FT                   GTGKTSVVQRVAINWLQEEQLGTNEIYSRNGQDPFWSGYKRHAVVTYDDFGAVPGTTSN
FT                   EAEIINVISRNPYATVMAGLAEKGMYFDSRLVLASSNFLAANPESGVHDSEAYERRRHA
FT                   VIRVSLKPGVPYNADDPCANQAYTLLESKTPFREIQTFETYAELWSYLYTSFKEHEVQE
FT                   ELYLKSLPILDSDKKEALEGLVGLTVIATSFAPKAVMQYGVEKFPGYHFLVSDGEKCYF
FT                   WHGDGSVESASVEQMQLSKQDVVQLKQQGLSTAMMYKDLAKAFPTLNSLAVLYAKNIVV
FT                   KRWVGPDLEPMKSCEDVYMREQIGNLPKWQRAYLYVLSKYLTTQSPRGWFMECLEETKK
FT                   NLRATYLWEYKQWPLPLKLALGSLIAIMAGGAIWYSLQSLWCMSGDASFVAGAATVFSV
FT                   SSFAGQSDIPNRDNSERSFRNRKVRARTWQGQSSCFGDSALWIAETCMATLTFSNVRTQ
FT                   VCLAPGRGFFGVNHCLVAIPAGVMVKMDSSIGVTYFVWEKEKLMQFDGNEIALYMTSTL
FT                   PKTVDSLLGRIHFDVETLPKTFSAVFFSYKYDPMIQQMVPELGSVTCKVHNKAYTLAHG
FT                   EYRREIPQSLSYEASTVAGDCGSLILAEIDGKFKLVGMHVAFNGREGSASFIPYHASLD
FT                   QKVGQGEFMLKYQEWAEPKILGPGCRAMGLIEPEHALAASGKTTFVETPEEWHLDYPCD
FT                   KLPSVLARGDPRLAGTVHADYDPFASGMSKYAKEAGPFDAASLKQVCSGIVEIWEDASA
FT                   DFPMDEVDLDTAINGLENVEFFDALVLGTSEGFPYRLDRGPGDKGKSRYVSGESGNLKI
FT                   TDEGVLSDIAWFEEVSKTQVPDLYCIECVKDERLPIRKVLHEPKSRLFTVLPMSYNIVI
FT                   RKKFLNFVRFFMKRRDVLPAQVGINPYSREWTRMANKLLSKGNNILCCDYSRFDGFLPK
FT                   CIMNEIGNMIARLMRVDEVSRTQIKNLMLACTSRYAMCNRVLYRVENGIPSGFPLTVIV
FT                   NSILNEILVKYAYWHCFEDNPSVQSNFDAHVSMVVYGDDNLISVSDAISSKFDGSFLVS
FT                   FMEGLGIKVTDGIDKTKVGIEFRRLENCDFLKRSFKMSPDGTWRSPMSKESLWPQLHFV
FT                   KAKKLEMAEAYINNCNNILRELWLHDVKEAKEFRNKVLRNLRWIGHEQLLNMQQLAVFH
FT                   SEQMNGVSDFLSTCVTVDSIPLMDPLVPGLLPVKTCEIIPRVFVAAEKHFEGNFNDFFT
FT                   ISITTSRKFEEDKGFVLLFPYGAGRGGLPTTQFMRENVIRKGCSIQKKFRQAYEKGNNI
FT                   LFISQSSVVPAYVFAVMLLHSIGAITRLSSNKALTQAMQTCKRLEYLPKEYEEFF"
FT   mat_peptide     234. .1271
FT                   /product="putative protease cofactor"
FT   mat_peptide     1272. .3041
FT                   /product="NTP-binding protein"
FT                   /function="helicase"
FT   mat_peptide     3042. .3119
FT                   /gene="VPg"
FT                   /product="genome-linked protein"
FT   mat_peptide     3120. .3746
FT                   /product="cysteine protease"
FT   mat_peptide     3747. .5843
FT                   /gene="RdRp"
FT                   /product="RNA-dependent RNA polymerase"
XX
SQ   Sequence 5956 BP; 1685 A; 1001 C; 1550 G; 1720 T; 0 other;

ab050782 Length: 5956  30-JAN-2009  Type: N  Check: 5288  ..
       1  gttttaataa aatattgaaa caaacagctt tcgttccgaa aaacagcttt
      51  cagttactaa acagctttcg ttccgataaa acagctttca gaaacaaaca
     101  gctttcaatt ttctttcgga aaatttagtt actgcgtggc tttggaaaga
     151  acccggaaaa agggagtgtg atttaaagcg caccatatat ttcaaagatc
     201  atattgattt cattttgcta ccttaatttt aaaatggact tcagtacgat
     251  gcaagtggtt gtgggatttt tgaagacttc gatgggttta caatccattc
     301  gagacattgt gcagaaagca aaggtggatg agaaagacaa aacattgctt
     351  cacatccacc tgtgcttctt tcatgccaat gaaatggccc gagatttgaa
     401  cgaaggcatg gatgtgagcc agatacatag ctcttcagct atcaagtatc
     451  gggccgcaat tgttacgcgc catgtgaaga tgaatgtgga aaccggaagg
     501  tatgatagga aacgcatggt ggaatacaac aacgaagcat gtatcaattg
     551  gttttcctgt gaattcatgg aggaaaaagg ggagaatcag gagctactag
     601  ttggagaagg tcgtgtggaa gaaattgttg acgagtttct agcaaactgc
     651  aacgtctctg agcgcaatga tcaagtgtcc actgtgagaa atgccaatta
     701  tgcatttggc cagggattgt atgagtacgc aactcgtgtc agtgatgcaa
     751  tagtggcagt gatttcagga tcaatcaaga aaggcataga tgagtttttg
     801  gacaaagtgt acacggctat gaatcagatt tttgcagcgt ggatgcccaa
     851  gattagagct gcttttcagt ggttcgagaa tatcaaagag gtcgtgaaga
     901  agtgggtaaa cacaatgcac gagaagataa attgcatttt ggtaggtatg
     951  gaggattgtc tttacatggg agctggactc gttgcagcta catgtatcgt
    1001  cacattgctt gaaaagttca tggtggcaat tggcatcctt accaagcctt
    1051  gcggagcagc gactttgttt ttgacggctg ctatggcagc tatttctgcc
    1101  gcatatgtgt gttccaaggc cgtagaaaag tcggttatgc ttagcaattt
    1151  gctacacttt gtgacttcca attgccaaat tgtgttgagc gctttgttca
    1201  atcatgatgc gacaaagaaa gagttgactg cgaaccaaga tggaagtgaa
    1251  gtaccaatag gccttggcca gtttggagtt tcaacgatgc tgcaagacgt
    1301  ggcaaacttg atgtcaacgt ggtccacaaa ttcagtcact gaaattggaa
    1351  gaacattcgg tgctatttcg cagatcaaga atggtatttt agctttgaaa
    1401  gacatgattt attttgtgtt tgagaagttg agtgacttag ctcataaagt
    1451  gttgggtttt gaatctcaag ttttggctga tcttacaatt cttttgggtg
    1501  agaacgttgc agattggttg tccgagtgcg actgcatggt ctcttatatg
    1551  cttgagttta actcaaggaa tagggagata tttgataggc tctcacaact
    1601  cattgagaaa ggcagactta tatgcacagg agtgttgagg acaggccacc
    1651  gtggctcttc gcaggtcatg gcacttgtca ccaaggcttt agagaaactg
    1701  atagagttgc acaattcagt agtgatgtct gggtccaata ccactaggaa
    1751  atctcccttt atggtttttt tcacaggtgc ttcgggtaca gggaaaacct
    1801  cggttgtgca gagggtagcc atcaattggt tgcaggagga acaactgggc
    1851  acaaatgaga tatattcgcg caatgggcag gatccttttt ggtcaggtta
    1901  caagagacat gcagttgtca cgtatgacga ttttggcgct gttccaggta
    1951  caacctcgaa tgaagctgaa atcatcaacg tgatatcgag aaatccgtat
    2001  gctacagtta tggcaggatt ggcagagaaa ggcatgtact tcgattcgag
    2051  attggttcta gctagtagta attttctggc tgctaacccc gagtcaggag
    2101  ttcatgactc agaggcatat gaacggcgaa gacatgcggt tattagagtt
    2151  tctctcaagc ctggagtgcc ttataatgca gatgacccat gtgccaatca
    2201  ggcgtacact ttgcttgagt ccaaaacacc ttttagggag atacaaacat
    2251  ttgagactta tgcagaatta tggtcttatt tgtacacaag cttcaaggag
    2301  catgaggtgc aggaggagtt gtatttgaaa tccttgccca ttttggattc
    2351  agataagaaa gaagctttgg aaggccttgt gggtctcaca gttatagcca
    2401  cttcatttgc tcctaaggca gtaatgcaat acggagttga aaaattccca
    2451  gggtaccatt ttttggtttc tgatggggag aagtgttatt tctggcatgg
    2501  agatggttca gtggagagtg ctagtgtgga gcagatgcaa ttgagtaagc
    2551  aagatgtggt acaattaaag caacaaggac tgtcgacagc gatgatgtac
    2601  aaggatttag ctaaagcttt tccaactttg aattcattgg ctgtgctgta
    2651  tgctaagaac atcgtagtga aacgttgggt ggggcctgac ttggaaccca
    2701  tgaaaagttg tgaggatgtt tacatgaggg agcaaatagg caacttgccg
    2751  aaatggcaaa gggcatattt gtacgtgctt agcaagtact tgacaaccca
    2801  aagtccacgt ggctggttca tggagtgtct tgaagagaca aagaagaatt
    2851  tgagagcgac ctatttatgg gagtacaagc aatggccatt acctttgaaa
    2901  ttggctttgg gttctttgat agccatcatg gcaggtggag caatttggta
    2951  ttcacttcaa tctttatggt gcatgtcagg agacgcctct tttgtggcag
    3001  gagcagcgac ggttttctca gtttcttcat ttgctggaca gagcgatatt
    3051  cctaatcgag ataattcaga gcgatcattt agaaacagga aggtgcgtgc
    3101  taggacgtgg caaggtcaaa gttcatgttt tggcgactca gctttatgga
    3151  ttgctgagac atgtatggcg acattgacat tctctaatgt taggacgcaa
    3201  gtgtgcttgg ctcctggcag agggttcttt ggagtgaatc attgtctcgt
    3251  agcgattccc gcaggggtta tggtgaaaat ggattctagt attggagtga
    3301  cctattttgt gtgggagaag gaaaagttga tgcaatttga tggaaatgaa
    3351  atagccttgt acatgacgag cactttacct aagacggtgg actctctttt
    3401  agggaggatt cattttgatg tggaaacttt gcccaagact tttagtgctg
    3451  tcttcttttc ttataagtat gatccaatga ttcaacaaat ggtgcctgaa
    3501  cttgggagtg ttacatgcaa agtccacaat aaggcttaca cgcttgctca
    3551  tggtgagtac aggagggaaa ttccccaaag tctttcatat gaagctagca
    3601  ctgtagctgg agattgtggt tctttgatat tggcagagat tgatggaaaa
    3651  ttcaagcttg ttggcatgca cgtggctttc aatggaagag aaggaagtgc
    3701  aagtttcata ccctatcatg ctagtttgga ccagaaggtt ggccaaggag
    3751  agttcatgtt gaagtaccag gaatgggcag agcctaagat tctggggcca
    3801  gggtgtagag caatgggtct catagaacca gagcatgctt tagcggctag
    3851  cggaaagaca acatttgttg agacaccaga agaatggcat ctagattacc
    3901  cgtgtgataa acttccaagt gtgctggccc gaggagatcc aagattggca
    3951  ggaacagtcc atgcagatta tgacccattt gcttctggga tgagtaagta
    4001  cgccaaggag gcaggccctt ttgatgcagc tagtcttaag caagtgtgtt
    4051  caggaattgt tgagatatgg gaggatgctt cggcagattt tcccatggat
    4101  gaggtagatt tggacactgc tattaatggt ttggagaacg tggaattctt
    4151  tgatgctttg gttcttggga catcagaggg atttccttat cggcttgatc
    4201  gtggtcctgg tgacaagggt aagagcaggt acgtatcggg agagagtggc
    4251  aacttgaaaa taactgacga aggagtcctt tcagatatag cttggtttga
    4301  agaagtgagc aaaactcagg taccagatct ttattgcatt gagtgtgtaa
    4351  aagatgaacg tttgccgatt cggaaagtgt tgcatgaacc caagagcagg
    4401  ttgttcacag tgctaccaat gtcttacaac atcgttatca gaaagaaatt
    4451  tctgaacttt gttagattct tcatgaaaag gcgtgatgtg ctaccggctc
    4501  aagttgggat taatccttac tcacgagaat ggacccgaat ggctaacaag
    4551  ttgctgagca aaggaaacaa cattttgtgc tgtgactaca gtagatttga
    4601  tggctttctg cccaagtgca tcatgaacga gataggcaac atgatagcta
    4651  ggctcatgag agttgatgag gtgtcaagga cccagataaa gaacttaatg
    4701  ctagcatgca ctagtaggta tgccatgtgc aacagagttt tatacagagt
    4751  tgaaaatggc atcccatccg ggtttccctt gacagtcatt gtgaattcca
    4801  tcttgaatga aatcttggtt aagtatgcgt attggcactg ttttgaagac
    4851  aacccgagtg tgcagagcaa ctttgatgct catgtgtcga tggttgttta
    4901  tggggatgac aatttgattt ccgtgtcaga tgcaattagt tcaaagtttg
    4951  atgggagttt tcttgtgagt ttcatggaag gtttggggat taaagtgact
    5001  gatgggattg acaaaacaaa ggtcggaatt gagtttcgga gattggagaa
    5051  ttgtgatttc ttgaaacgtt ctttcaagat gagcccggat ggtacctggc
    5101  gtagtcccat gtctaaagag agtttgtggc cacaattgca ttttgtcaag
    5151  gcaaagaaat tagaaatggc agaggcatac atcaacaatt gcaataatat
    5201  tttgcgtgaa ttgtggttgc atgacgttaa agaggccaaa gagtttcgca
    5251  ataaagtctt gaggaatttg agatggattg gacatgagca attgctaaac
    5301  atgcagcagt tggcagtttt ccacagtgag cagatgaatg gagtgagcga
    5351  ctttttgtca acttgtgtaa cagtggatag cataccattg atggatcctt
    5401  tggtgcctgg attgttgcca gtcaaaacat gtgagataat cccccgagtc
    5451  tttgtggcag cagagaaaca ttttgaaggg aatttcaatg atttcttcac
    5501  gatttcaata accacaagcc gcaagttcga agaagataag ggatttgttc
    5551  ttttgtttcc gtacggagct ggaagaggag gattgccaac cacgcagttc
    5601  atgagagaga atgtcataag gaaaggatgc tcgattcaga agaagtttag
    5651  gcaggcgtat gagaaaggaa ataatattct cttcatttca cagagttcgg
    5701  tagttcctgc ttatgttttt gctgtgatgc ttttacattc cataggggca
    5751  atcactagat tatcaagcaa taaagcactc actcaagcga tgcaaacttg
    5801  caagaggttg gagtatttac ctaaagagta tgaagaattc ttttgatttt
    5851  gtgtgtgttt tgggtgtata ttttatgtaa atcactactt ttattgtata
    5901  atatgtatta tgcagggttg aaatgccttt tcccaagtaa atttcagtag
    5951  tgaggg