!!NA_SEQUENCE 1.0
ID   AB051386   standard; RNA; VRL; 5957 BP.
XX
AC   AB051386;
XX
SV   AB051386.1
XX
DT   22-NOV-2000 (Rel. 65, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 3)
XX
DE   Broad bean wilt virus 2 gene for 210kDa protein precursor, complete cds.
XX
KW   .
XX
OS   Broad bean wilt virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Fabavirus.
XX
RN   [1]
RP   1-5957
RA   Kuroda T., Takeda I., Suzuki K.;
RT   ;
RL   Submitted (20-NOV-2000) to the EMBL/GenBank/DDBJ databases.
RL   Kazumi Suzuki, Iwate Biotechnology Research Center; 22-174-4 Narita,
RL   Kitakami, Iwate 024-0003, Japan (E-mail:kasuzuki@sv02.ibrc.pref.iwate.jp,
RL   Tel:81-197-68-2911, Fax:81-197-68-3881)
XX
RN   [2]
RA   Kuroda T., Takeda I., Suzuki K.;
RT   "Nucleotide sequence of broad bean wilt virus 2 RNA1";
RL   Unpublished.
XX
DR   GOA; Q9E933.
DR   SPTREMBL; Q9E933; Q9E933.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5957
FT                   /db_xref="taxon:76875"
FT                   /mol_type="genomic RNA"
FT                   /organism="Broad bean wilt virus 2"
FT                   /isolate="IA"
FT                   /segment="1"
FT   CDS             235. .5847
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9E933"
FT                   /db_xref="SPTREMBL:Q9E933"
FT                   /transl_table=1
FT                   /product="210kDa protein precursor"
FT                   /protein_id="BAB18312.1"
FT                   /translation="MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKVDEKDKTLLHIHLCF
FT                   FHANEMARDLNEGMDISQIHSSPAIKYRAAIVMRHVNMNVETGRYDRKRMMEYNNETCV
FT                   NWFSCEFMEEKEKNQELPVEEGHVGEIVDEFLANCNISERNDQVSTVGNVNHAFGQGLY
FT                   EYATRVSDAIVAVISGSIRKGIDEFLDKVYTAMNQIFAAWMPKIKAAFQWFENIKDVVK
FT                   KWANTMHEKINCILVGMEDCLYMGAGLVAATCIVTLLEKFMVAIGILTKPCGAATLFLT
FT                   TAMAAISAAYVCTKAVEKSVMLTNLLHFVTSNCQIVLSTLFNHDATKKELTAHQDGSEA
FT                   PIGLGQFGISTMLQDVANLMSTWSVNSVTEIGRTFGAISQIKNGILALRDMIYFVFEKL
FT                   SDLAHKVLGFESQVLADLTILLGENVADWLSECDCMVSYMLEFNSRNREIFDRLSQLIE
FT                   KGRLIRTGVLRTGHRGSSQVMALVTKALEKLIELHNSVVMSGSNTTRKSPFMVFFTGAS
FT                   GTGKTSVVQRVAINWLQEEQLGTNEIYSRNGQDPFWSGYKRHAVVTYDDFGAVPGTTSN
FT                   EAEIINVISRNPYATVMAGLAEKGMYFDSRLVLASSNFLAANPESGVHDSEAYERRRHA
FT                   VIRVSLKPGVPYNADDPCANQTYTLLESKTPFREIQTFETYAELWSYLYTSFKEHEVQE
FT                   ELYLKSLPILDSDKKEALEGLVGLTVIATSFAPKAVMQYGVEKFPGYHFLVSDGEKCYF
FT                   WHGDGSVESASVEKMQLSKQDVAQLKQQGLSTAMMYKDLAKAFPTLNSLAVLYAKNIVV
FT                   KRWVGPDLGPTKICEDVYMREQIGNLPKWQRAYLYVLSKYLTTQSPRGWFMECLEETKK
FT                   NLRATYLWEYKQWPLPLKLALGSLIAIMAGGAIWYSLQSLWCMSGDASFVAGAATVFSV
FT                   SSFAGQSDIPNRDNSERSFRNRKVRARTWQGQSSCFGDSALWIAETCMATLTFSNVKTQ
FT                   VCLAPGRGFFRVNHCLVAIPAGVMVKMDSSIGVTYFVWEKEKLVQFDGNEIALYMTSTL
FT                   PKTVDSLLGRIHFDVETLPKTFNAVFFSYKYDPMIQQMVPELGNVTCKIHNKAYTLAHG
FT                   EYRREIPQSLSYEASTVAGDCGSLILAEIEGKFKLVGMHVAFNGREGSASFIPYHASLD
FT                   QKVGQGDFMLKYQEWAEPKILGPGCRAMGLIDPEHALAASGKTTFVETPEEWQLDYPCD
FT                   KLPSVLARGDPRLAGTVHADYDPFASGMSKYAKEAGPFDAASLKQVCSGIVEIWEDASA
FT                   DFPMDEVDLDTAINGLENVEFFDALVLGTSEGFPYRLDRGPGDKGKSRYVSGESGNLKI
FT                   TDEGVLSDIAWFEEVSKTQVPDLYCIECVKDERLPIRKVLHEPKSRLFTVLPMSYNIVI
FT                   RKKFLNFVRFFMKRRDVLPAQVGVNPYSREWTRMANKLLSKGNNILCCDYSRFDGFLPK
FT                   CIMNEIGNMIARLMKVDEVSKAQIKNLMLACTSRYAMCNRVLYRVENGIPSGFPLTVIG
FT                   NSILNEILVKYAYWHCFEDNPSVQSNFDAHVSMEEYGDDNLISVSDAISSKFDGSFLVS
FT                   FIEGLGIKVTDGIDKTKIGIEFRRLENCDFLKRSFKMSPDGTWRSPMSKESLWPQLHFV
FT                   KAKKLEMAEAYINNCNNILRELWLHDVKEAKEFRNKVLRNLRWVGHEQLLNMQQLAVFH
FT                   SEQMNGVSDFLSTCVTVDSIPLMDPLVPGMLPVKTCEIIPRIFVAAEKHFEGNFNDFFT
FT                   ISITTSRKFEEDKGFVLLFPYGAGRGGLPTTQFMRENVIRKGCSIQKKFRQAYEKGNNI
FT                   LFISQSSVVPAYVFAVMLLHSIGAITRLSSNKALTQAMQTCKRLEYLPKEYDEFF"
XX
SQ   Sequence 5957 BP; 1702 A; 988 C; 1538 G; 1729 T; 0 other;

 AB051386  Length: 5957  July 15, 2003 09:17  Type: N  Check: 9484  ..
       1  tgttttaata aaatattgaa acaaacagct ttcgttccga aaaacagctt
      51  tcagttacta aacagctttc gttccgataa aacagctttc agaaacaaac
     101  agctttcaat tttctttcgg aaaatttagt tactgcgtga ctttggaaag
     151  aacccggaaa aagggagtgt gatttaaagc gcgccatata tttcaaagat
     201  catattgatt tcattttgct accttaattt taaaatggat ttcagtacga
     251  tgcaagtggt tgttgggttt ttgaaaactt cgatgggttt acaatccatt
     301  cgagacattg tgcaaaaagc aaaggtggat gagaaagaca agacattgct
     351  tcacatccac ctgtgttttt tccatgccaa tgagatggca cgagatttga
     401  atgaaggcat ggacattagc cagatacata gctcaccagc tatcaagtat
     451  agggcagcga ttgtcatgcg ccatgtgaat atgaatgtgg aaaccgggag
     501  gtatgatagg aaacgcatga tggaatacaa caatgaaaca tgtgtcaatt
     551  ggttttcctg tgaattcatg gaggaaaaag agaagaatca ggagttgcca
     601  gttgaagaag gacatgtggg agagattgtt gatgaatttc tagcaaattg
     651  caacatttct gagcggaatg atcaagtgtc cactgtgggg aatgtcaatc
     701  atgcgtttgg ccagggatta tatgagtacg caactcgtgt cagtgacgca
     751  atagttgcgg tgatctcagg atcaatcagg aagggtatag atgaattctt
     801  ggacaaagtg tacacggcta tgaatcagat atttgcagcg tggatgccca
     851  agattaaggc cgcttttcag tggtttgaga atatcaaaga cgttgtgaaa
     901  aagtgggcaa atactatgca tgagaagata aattgcattt tggtaggtat
     951  ggaggattgc ctatatatgg gagctggact tgtagcagct acatgtattg
    1001  tcacactact tgaaaagttt atggtggcaa ttggcattct tactaaacct
    1051  tgcggggcag cgactttgtt tttaacgact gctatggcag ctatttcagc
    1101  cgcgtatgtg tgcaccaagg ccgtggagaa gtcggtgatg cttaccaatt
    1151  tattacattt tgtaacttcc aattgccaaa ttgtgttgag cactttgttc
    1201  aatcatgacg cgaccaagaa agagttaact gcacatcaag atggaagcga
    1251  agctccaata ggccttggcc aatttggaat ttcaacgatg ttgcaagacg
    1301  tggcaaactt gatgtcaaca tggtccgtga attcagtcac ggaaattgga
    1351  agaacatttg gtgctatttc acagatcaag aatggtatat tggctttgag
    1401  ggacatgatt tattttgtgt tcgagaaatt gagtgatttg gctcacaaag
    1451  tattgggttt tgagtctcag gttttagctg atctcacaat tcttctgggt
    1501  gagaacgttg cggattggct gtctgaatgt gattgtatgg tctcttatat
    1551  gcttgaattt aattcaagga atagggagat atttgatagg ctctcacaac
    1601  tcattgagaa aggcagactt atacgcacag gagtgttgag gacaggtcat
    1651  cgtggctctt cacaagttat ggcacttgtt accaaagcct tggagaagct
    1701  gatagaattg cacaattcag ttgtgatgtc tgggtctaat accactagga
    1751  aatctccttt tatggttttt ttcacaggtg cctcaggcac aggtaagact
    1801  tcggttgtgc agagagttgc cattaattgg ttgcaagagg aacaactggg
    1851  cacaaatgag atatattcgc gcaatgggca agacccattt tggtcaggtt
    1901  ataagaggca tgcagttgtt acatatgatg attttggtgc cgttccaggt
    1951  acaacatcga atgaggctga gatcatcaat gtaatatcaa ggaatccgta
    2001  cgcaacggtc atggcaggat tggcagagaa agggatgtat tttgattcga
    2051  ggttagtttt agccagtagt aattttttgg ctgctaaccc cgagtcagga
    2101  gttcatgatt cagaggcata tgaacggcga agacatgcgg tgatcagagt
    2151  ttctctcaag cctggggtgc cctacaatgc agatgatcca tgcgccaatc
    2201  agacgtacac tttgcttgaa tctaaaacac cttttaggga aattcagaca
    2251  tttgagactt acgcggagtt gtggtcttac ttgtacacaa gtttcaagga
    2301  gcatgaggtg caagaagagt tgtatttgaa atctttacct attttggatt
    2351  cggataagaa ggaagctcta gaaggccttg tgggtctcac agttatagcc
    2401  acttcatttg ctcctaaagc agtaatgcaa tatggagttg aaaaattccc
    2451  aggttaccat ttcttggttt ctgacgggga gaagtgctac ttctggcatg
    2501  gagatggctc agtggagagt gctagtgtgg agaagatgca attgagcaaa
    2551  caggacgtgg cgcaattgaa gcaacaggga ttgtcaacag cgatgatgta
    2601  caaggacttg gctaaagcct ttccaacttt gaattcatta gctgtgttgt
    2651  atgccaagaa tatcgtggta aagcgctggg tggggcctga tttggggcct
    2701  acgaaaattt gtgaagatgt ttacatgcgg gagcaaatag gaaacttgcc
    2751  aaaatggcaa agggcgtact tgtacgtgct tagcaagtac cttacaactc
    2801  agagtccacg tggatggttc atggaatgct tggaggagac gaagaagaat
    2851  ttgagagcga cttatttgtg ggagtacaag cagtggccat tacctttgaa
    2901  attggctttg ggttctctga tagccatcat ggcaggcgga gcaatttggt
    2951  actcgttgca atctctatgg tgtatgtcag gagacgcctc tttcgtggca
    3001  ggtgcagcaa cagttttttc agtttcttca tttgcaggac agagtgacat
    3051  tcctaatcga gataattcag agagatcgtt tagaaatagg aaggtgcgtg
    3101  ctaggacatg gcaaggtcaa agttcatgtt ttggagattc agctttgtgg
    3151  attgcagaga cgtgtatggc gacattaaca ttttccaatg ttaagacgca
    3201  agtgtgctta gctcctggta ggggtttttt tcgggtaaat cactgccttg
    3251  tagcaattcc tgcaggagtt atggtgaaga tggattctag cattggagtg
    3301  acatatttcg tgtgggagaa agagaagcta gtgcagtttg atggtaatga
    3351  gattgctttg tacatgacaa gcactttgcc caagacagtg gattctcttc
    3401  tggggagaat tcatttcgat gtagaaactt tgcccaagac tttcaatgct
    3451  gttttcttct cttacaagta tgatccaatg atccagcaga tggtgcctga
    3501  gttagggaat gtcacatgta aaatccataa caaggcctac acgcttgccc
    3551  atggcgagta cagaagggaa attccccaaa gtctttcata tgaagccagc
    3601  actgtagcgg gagattgtgg ttctttgata ttggcagaga ttgaaggaaa
    3651  attcaagctt gttggcatgc acgtggcttt taacggaaga gaagggagcg
    3701  caagttttat accttaccat gccagtttgg atcagaaggt tggccaagga
    3751  gattttatgt tgaagtacca agaatgggca gaacctaaga ttctggggcc
    3801  aggatgtaga gcaatgggcc ttatagatcc agagcatgct ttggcggcta
    3851  gtgggaagac aacatttgtt gaaactccag aagagtggca attagattac
    3901  ccgtgtgaca aacttccaag tgtgttagct cgaggagatc cgaggttggc
    3951  aggaacagtt catgcagact acgatccatt tgcttctggg atgagcaagt
    4001  atgctaagga ggcaggtcct ttcgacgcgg ctagtcttaa gcaagtgtgt
    4051  tcaggaattg ttgagatatg ggaagacgct tcggcagatt ttcctatgga
    4101  tgaagtggat ttggacactg ccattaatgg tttggagaat gtggaattct
    4151  ttgatgcctt ggtacttggg acttctgagg gattcccata tcgacttgat
    4201  cgtggtcctg gtgacaaggg taagagcagg tacgtgtcgg gtgagagtgg
    4251  caacctgaaa ataactgacg aaggagtcct ttcggacata gcttggtttg
    4301  aagaagtgag caaaactcag gtgccagatc tttattgcat tgaatgtgtc
    4351  aaggatgaac gtttaccgat caggaaagtg ttacatgagc ccaagagcag
    4401  attgttcaca gtgcttccaa tgtcttataa catcgtcata aggaagaaat
    4451  tcctaaactt tgttaggttc ttcatgaaaa ggcgagatgt gctaccggcc
    4501  caagtcgggg tcaatcctta ttcacgagaa tggacccgaa tggctaacaa
    4551  gttgttgagc aaagggaaca acattttgtg ctgtgattac agcagattcg
    4601  atggcttttt gcccaagtgc attatgaacg agataggcaa catgatagct
    4651  aggctcatga aggttgatga agtgtcaaaa gctcagataa agaatttaat
    4701  gcttgcatgt actagcaggt atgccatgtg caatagagtt ttatacagag
    4751  ttgaaaatgg cattccatca gggtttcctt taacagttat tggaaattcc
    4801  atcttgaacg agattttggt taagtatgct tactggcatt gcttcgaaga
    4851  taacccaagt gtgcaaagca actttgatgc tcatgtttcg atggaagaat
    4901  atggggacga caatttgatt tctgtgtcag acgccattag ttcaaagttt
    4951  gatgggagtt ttcttgtgag ttttatagaa ggcttgggga tcaaagtgac
    5001  agatgggatt gacaaaacga agattggaat tgagttccgg agattagaga
    5051  attgcgactt tctgaagcgt tccttcaaga tgagcccaga tggtacttgg
    5101  cgtagtccca tgtctaaaga gagtttgtgg ccacaattgc attttgttaa
    5151  ggcaaagaaa ctggaaatgg cagaggcata catcaacaat tgcaataata
    5201  tcttgcgtga attgtggttg catgacgtta aagaggccaa agagtttcgc
    5251  aacaaagttt tgaggaatct gagatgggta gggcatgagc aattgcttaa
    5301  tatgcagcag ttggcggttt ttcacagtga gcagatgaat ggagtgagtg
    5351  atttcttatc aacttgtgta acagtggata gcataccatt gatggatcct
    5401  ttggtgcctg ggatgttgcc agtcaaaaca tgtgagataa ttccccggat
    5451  tttcgttgca gcagagaaac attttgaagg gaacttcaac gactttttca
    5501  caatttcaat aaccacgagc cgtaagttcg aagaagataa gggatttgtt
    5551  cttttgtttc catatggagc tggtagagga ggtttgccaa ccactcagtt
    5601  catgagagaa aatgtcataa ggaaaggatg ctcgatacaa aagaagttta
    5651  ggcaagctta cgagaaagga aacaacattc tctttatttc acagagttca
    5701  gtagttcctg cttatgtttt tgctgtgatg cttttgcatt ctataggggc
    5751  gattactagg ttatcaagca ataaggcgct cactcaagca atgcaaactt
    5801  gtaagaggtt ggagtattta cctaaagagt atgatgagtt cttttgattt
    5851  tgtgtgtgtt ttgtgtgtat attttatgta aatcactact tttattgtat
    5901  aatatgtatt atgcagggtt gaaatgcctt ttcccaagta aatttcagta
    5951  gtgaggg