!!NA_SEQUENCE 1.0
ID   AF056575   standard; RNA; VRL; 15468 BP.
XX
AC   AF056575;
XX
SV   AF056575.1
XX
DT   02-JUL-1998 (Rel. 56, Created)
DT   02-JUL-1998 (Rel. 56, Last updated, Version 1)
XX
DE   Beet yellows virus Californian isolate, complete genome.
XX
KW   .
XX
OS   Beet yellows virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-15468
RX   MEDLINE; 98285746.
RA   Peremyslov V.V., Hagiwara Y., Dolja V.V.;
RT   "Genes required for replication of the 15.5-kilobase RNA genome of a plant
RT   closterovirus";
RL   J. Virol. 72(7):5870-5876(1998).
XX
RN   [2]
RP   1-15468
RA   Dolja V., Peremyslov V., Hagivara Y.;
RT   ;
RL   Submitted (31-MAR-1998) to the EMBL/GenBank/DDBJ databases.
RL   Botany and Plant Pathology, Oregon State University, 2082 Cordley Hall,
RL   Corvallis, OR 97331, USA
XX
DR   SPTREMBL; O89906; O89906.
DR   SPTREMBL; O89907; O89907.
DR   SPTREMBL; O89908; O89908.
DR   SPTREMBL; O89909; O89909.
DR   SPTREMBL; O89910; O89910.
DR   SPTREMBL; O89911; O89911.
DR   SPTREMBL; O89912; O89912.
DR   SPTREMBL; Q96667; Q96667.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .15468
FT                   /db_xref="taxon:12161"
FT                   /organism="Beet yellows virus"
FT                   /isolate="Californian"
FT   mat_peptide     108. .1871
FT                   /gene="ORF1a/b"
FT                   /function="autoproteolysis"
FT                   /function="replication enhancer"
FT                   /product="papain-like leader peptide"
FT   CDS             join(108. .7983,8045. .9381)
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O89906"
FT                   /gene="ORF1a/b"
FT                   /product="fusion protein"
FT                   /protein_id="AAC25115.1"
FT                   /translation="MAFLNVSAVPSCAFAPAFAPHAGASPIVPDSFPCVPRYSDDISHF
FT                   RLTLSLDFSVPRPLFLNARVHLRASTDNPLPSLPLGFHAETFVLELNGSSAPFSIPSRH
FT                   IDFVVNRPFSVFPTEVLSVSSLRTPSRLFALLCDFFLYCSKPGPCVEIASFSTPPPCLV
FT                   SNCVAQIPTHAEMESIRFPTKTLPAGRLLQFHKRKYTKRPETLIIHESGLALKTSALGV
FT                   TSKPNSRPITVKSASGEKYEAYEISRKDFERSRRRQQTPRVRSHKPRKINKAVEPFFFP
FT                   EEPKKDKRKRASLPTKDEGFITFGTLRFPLSETPKEEPRLPKFREVEIPVVKKHAVPAV
FT                   VSKPVRTFRPVATTGAEYVNARTQCSRRPRNHPILRSASYTFGFKKMPLQRFMKEKKDY
FT                   YVKRSKVVSSCSVTKSPLEALTSILKNLPRYSYNSERLKFYDHFIGDDFEIEVHPLRGG
FT                   KLSVLLILPKGEAYCVVTAATPQYHAALTIARGDRPRVGELLQYRPGEGLCYLAHAALC
FT                   CALQKRTFREEDFFVGMYPTKFVFAKRLTEKLGPSALKHPVRGRQVSRSLFHCDVASAF
FT                   SSPFYSLPRFIGGVEEEAPEITSSLKHKAIESVYERVSIHKDNLLARSVEKDLIDFKDE
FT                   IKSLSKEKRSVTVPFYMGEAVQSGLTRAYPQFNLSFTHSVYSDHPAAAGSRLLENETLA
FT                   SMAKSSFSDIGGCPLFHIKRGSTDYHVCRPIYDMKDAQRRVSRELQARGLVENLSREQL
FT                   VEAQARVSVCPHTLGNCNVKSDVLIMVQVYDASLNEIASAMVLKESKVAYLTMVTPGEL
FT                   LDEREAFAIDALGCDVVVDTRRDMVQYKFGSSCYCHKLSNIKNIMLTPAFTFSGNLFSV
FT                   EMYENRMGVNYYKITRSAYSPEIRGVKTLRYRRACTEVVQVKLPRFDKTLKTFLSGYDY
FT                   IYLDAKFVSRVFDYVVSNCSVVNSKTFEWVWSYIKSSKSRVVISGKVIHRDVHIDLKHS
FT                   ECFAAVMLAVGVRSRTTTEFLAKNLNYYTGDASCFETIRFLFREWSRRAYAEINRSFRK
FT                   LMKSILSAGLDYEFLDLDNSLQHLLEYSEVEVRVSIAQNGEVDCNEENRVLTEIIAEAA
FT                   DRKSIAQGLSGALSSVPTQPRGGLRGGSRRSGVSFLYNLVEEVGNLFFSVGDAVRFLVK
FT                   VFKTFSDSPIFRVVRMFLDLAEAASPFVSVVSLCAWLREAVSAFSSWVADRTVSESVKT
FT                   FVNRTVKRFLNFMSAKTLTKKFFRFFLSASALAKTVVRKAKVILEAYWEVWFESILSDS
FT                   GEYSAVEFCSSVVITLLTNSGRLLPGFSPSAVITEVLLDLATKISIEVLLKQISPVDST
FT                   ASSALYRRVLSEILSNFRTMGEHGIFTKVFLLCGFLPVFVRKCVALCVPGDMATYARFL
FT                   EYGVDDLFFLGRSVNSIKNYLCVVAAGLVDSIVDSVVLKLSGVAKERVLGFKSKIIKNF
FT                   LNVFRKAKVVTRTSSSTDLSEDEYFSCDESKPGLRGGSSRFTLSRLLDIFFNFLKSSKL
FT                   VIENACFSAYERIERNMKLYFFPLNSSEEEARRLIRCAGDFDYLSDSAFDEDEMLRQAF
FT                   EQYYSSDDESVTYDGKPTVLRSYLNVSRRFLETFCNGPKFFVKVSNYFKALYSRLLRVL
FT                   PWVDRNLSDSPGLKGGNEKALLAKFLKTCVITACECVSQICCLRLIRLCWGTPACGLVR
FT                   LFYITYSGTRVLSRVVVAVAVCPLLVRNELDGLSDGLTNMGVSVFRRLFVALRRALSAY
FT                   SNSALRRKIFEFIFGNIHHPFDVAVIETNEVAPEPLSPEVDIDVDCDFGSDSESVSSDE
FT                   VASIPRPGLHGGSRRSSNFLTSLVKVVFKLAGRIPRLLFRLRNFVAYFVERRLASKRLK
FT                   TFIGLARLFDNFSLTSVVYLLQEYDSVLNAFIDVELVLLNSGSVNVLPLVSWVRGSLTK
FT                   LAEVIVGSGFASFLGRMCCRVSDWCSSSSNAGCNFMSPVRTKGKFVPPSSSGSTASMYE
FT                   RLEALESDIREHVLSTCRVGSDEEEERPKEVTEPGIEHTSEDVVPIRSHSQPLSGGECS
FT                   YSEDREENERANLLPHVSKIVSERRGLETARRNKRTLRGVSEFLNAINTSNEQPRPIIV
FT                   DHSPESRALTNSVREFYYLQELALFELSCKLREYYDQLKVANFNRQECLCDKDEDMFVL
FT                   RAGQGVVSGRNSRLPLKHFKDHEFCFRSGGLVPYDGTSRVDTIFHTQTNFVSANALLSG
FT                   YLSYRTFTFTNLSANVLLYEAPPGGGKTTTLIKVFCETFSKVNSLILTANKSSREEILA
FT                   KVNRIVLDEGDTPLQTRDRILTIDSYLMNNRGLTCKVLYLDECFMVHAGAAVACIEFTK
FT                   CDSAILFGDSRQIHYIDRNELDTAVLSDLNRFVDDESRVYGEVSYRCPWDVCAWLSTFY
FT                   PKTVATTNLVSAGQSSMQVREIESVDDVEYSSEFVYLTMLQSEKKDLLKSFGKRSRSSV
FT                   EKPTVLTVHEAQGETYRKVNLVRTKFQEDDPFRSENHITVALSRHVESLTYSVLSSKRD
FT                   DAIAQAIVKAKQLVDAYRVYPTSFGGSTLDISVNPSTSDRSKCKASSAPYEVINSFLES
FT                   VVPGTTSVDFGDVSEEMGTQVFESGADNVVIRDSAPVNKSTDHEENLYSYESRNYNFTV
FT                   CERFSGPQEFGQAMAMVMLERSFDLEKVAKVRSDVIAITEKGVRTWMSKREPSQLRALS
FT                   SDLQKPLNLEEEITTFKLMVKRDAKVKLDSSCLVKHPPAQNIMFHRKAVNAIFSPCFDE
FT                   FKNRVITCTNSNIVFFTEMTNSTLASIAKEMLGSEHVYNVGEIDFSKFDKSQDAFIKSF
FT                   ERTLYSAFGFDEDLLDVWMQGEYTSNATTLDGQLSFSVDNQRKSGASNTWIGNSIVTLG
FT                   ILSMFYYTNRFKALFVSGDDSLIFSESPIRNSADAMCTELGFETKFLTPSVPYFCSKFF
FT                   VMTGHDVFFVPDPYKLLVKLGASKDEVDDEFLFEVFTSFRDLTKDLVDERVIELLTHLV
FT                   HSKYGYESGDTYAALCAIHCIRSNFSSFKKLYPKVKGWVVHYGKLKFVLRKFANCFREK
FT                   FDTAFGEAYFLTYDET"
FT   mat_peptide     1872. .6233
FT                   /note="ORF 1a"
FT                   /gene="ORF1a/b"
FT                   /product="putative methyltransferase and RNA helicase"
FT   mat_peptide     join(7983,8045. .9378)
FT                   /note="ORF 1b; presumably expressed via a +1 ribosomal
FT                   frameshift"
FT                   /gene="ORF1a/b"
FT                   /product="RNA-dependent RNA polymerase"
FT   CDS             9445. .9609
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O89907"
FT                   /note="ORF 2; p6; small hydrophobic protein"
FT                   /function="unknown"
FT                   /product="6.4 kDa protein"
FT                   /protein_id="AAC25116.1"
FT                   /translation="MDCVLRSYLLLAFGFWICLFLFCLVVFIWFVYKQILFRNTPPSNE
FT                   ARFNRSTVV"
FT   CDS             9609. .11405
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O89908"
FT                   /note="homolog of HSP70 proteins; ORF 3"
FT                   /function="unknown"
FT                   /product="65-kDa protein"
FT                   /protein_id="AAC25117.1"
FT                   /translation="MVVFGLDFGTTFSSVCAYVGEELYLFKQRDSAYIPTFVFLHSDTQ
FT                   EVAFGYDAEVLSNDPSVRGGFYRDLKRWIGCDEENYGDYLEKLKPHYKTELLKVAQSSK
FT                   STVRLDCYSGTVPQNATLPGLIATFVKALISTASEAFKCQCTGVICSVPANYNCLQRSF
FT                   TESCVNLSGYPCVYMVNEPSAAALSACSRIKGATSPVLVYDFGGGTFDVSVISALNNTF
FT                   VVRASGGDMNLGGRDIDKAFVEHLYKKAQLPVNYKIDISFLKESLSKKVSFLNFPVVSE
FT                   QNVKVDVLVNVSELAEVAAPFVERTIKIVKEVYEKYRGSMRLEPSVKAKLLMVGGSSYL
FT                   PGLLSRLSSVPFVEECLVLPDARAAVAGGCALYSACLRNDSPMLLVDCAAHNLSISSKY
FT                   CESIVCVPAGTPIPFTGVRTVNMTGSNASAVYSAALFEGDFVKCRLNKRIFSGDVALGN
FT                   VGVSGSNTRTVPLTLEINVSSVGTITFSLVGPTGVKKLVGGNAAYDFSSYQLGERVVAD
FT                   LHKHNSDKVKLIHALTYKPFQRKKLTEGDKALFLKRLSADYRREAGKFSSYDDAVLNSS
FT                   ELLLGRVIPKILRGSRVEKLDV"
FT   CDS             11311. .12972
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O89909"
FT                   /note="ORF 4"
FT                   /function="unknown"
FT                   /product="64 kDa protein"
FT                   /protein_id="AAC25118.1"
FT                   /translation="MTTRFSTPANYYWGELFRRFFGGREWKNLMSEAASVRRPVYDRDF
FT                   RFSNGEVLSRKNFSDSTGESFVREFSLLLTFPKTYEVCKLCGVAMEQALSGMNRLSDYN
FT                   VSELNVVDVKTVGCKFNIQTVTEFVRKLNGNLAEPSLVEHCWSLSNSCGELINPKDTKR
FT                   FVSLIFKGKDVVESTDEAVVSSSYLDYLSHCLNLYETCNLSSNSGKKALYDEFLKYVIV
FT                   YLETSDLEYRSLSDNPLVAGVLYDMCFEYNTLKSTYLKNIESFDCFLSLYLPLLSEIFS
FT                   MNWEQPAPDVRLLFELDTTELLLKIPTINTHDSTFLYKNKLRYLESYFEDDSNELIKVK
FT                   VDSLLTRDNPELKLAQRWVGFHCYYGVFRTAQTRKVKRDAEYKLPPALGEFTINMSGVE
FT                   EFFDELQKKMPSVSVRRRFCGSLSHEAFSIFKRFGVGFPPITRLNVPVKYSYLNVDYYR
FT                   HVKRAGLTQDELTILSNIEFDVAEMCCEREVALQARRAQRGEKPFQGWKGVKNEVSPHA
FT                   RSSIRVKKNNESLLNVLWKDVGARRQGRLNPLHRKH"
FT   CDS             12920. .13570
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q96667"
FT                   /note="24 kDa protein; ORF 5"
FT                   /product="minor coat protein"
FT                   /protein_id="AAC25119.1"
FT                   /translation="MLAPEGRGDLIHFTENTRDAMETFFNSYDLAEYSEVNPNKLNRKE
FT                   TDELLGVIRERFKSELVITDEDFVKHLAFALIRAANITTSTKVNYVGAYEYTIGGKKFL
FT                   VKDAWVFPLIKECMKKFNKPNPVRTFCATFEDAYIVIARSLPKLFLNRTIGKRGIPSGY
FT                   EFLGADFLTATSVCLNDHEKAIVLQASRAAIDRAVSSSVDGKIVSLFDLGRLS"
FT   CDS             13641. .14255
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O89910"
FT                   /note="22 kDa protein; ORF 6"
FT                   /product="major coat protein"
FT                   /protein_id="AAC25120.1"
FT                   /translation="MGSAEPISAIATFENVSLVDQTCLHGEDCDKLRRNFEECLKLKGV
FT                   PEDKLGLALGLCLYSCATIGTSNKVSVQPTSTFIKASFGSGKELFLTHGELRSFLDSQK
FT                   LLEGKPNKLRCFCRTFQKDYISFAKEYRGRLPPIARANRHGLPAEDHYLAADFISTSTE
FT                   LTDLQQGRLLLARENATHTEFSSESPVTSLKQLGRGLATGK"
FT   CDS             14252. .14785
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O89911"
FT                   /note="ORF 7"
FT                   /function="unknown"
FT                   /product="20 kDa protein"
FT                   /protein_id="AAC25121.1"
FT                   /translation="MTSSVELAQTKPLFRVLLLKGFVFYIVAIETEEESPEVELPLVYL
FT                   HDLELNVNKKGKIESSYIDFKSCMTRLKPSSVSYTRVSSGKPSEDFSSSYSGKTFDSKI
FT                   LNRKVTFTFESGIQLVFGMYGRDQRCVSSEYLWFENVFVGAHCGTLPYCLNCELDKSGG
FT                   ELEILTFSKNEVFL"
FT   CDS             14769. .15302
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O89912"
FT                   /note="ORF 8"
FT                   /function="replication enhancer"
FT                   /product="21 kDa protein"
FT                   /protein_id="AAC25122.1"
FT                   /translation="MKFFFNDCETSRAISRSESLLRRVKELGTNSPQSEVSECINEFNE
FT                   LARFNHLLVTVEHRERMEKHPKQSSELRTPSRLGEMLKEIRAFLKVRVVTPMHKETASE
FT                   TLNAFLEEYCRITGLTREDALREKMRKVRSTVLFHHSELLKFEVTENMFSFTELLKLNL
FT                   SLRVISSQILGIAV"
XX
SQ   Sequence 15468 BP; 3874 A; 3472 C; 3696 G; 4426 T; 0 other;

AF056575  Length: 15468  December 21, 2001 14:50  Type: N  Check: 3374  ..
       1  gtttttaacc atccttctac tagacgtaca ctcgtacatc ctctagtatt
      51  tcctttattt atcttcccat aagcccctgc ctttaacgtt taactctcgc
     101  tatcgacatg gcattcttga acgtttctgc tgtccccagc tgtgctttcg
     151  cacctgcttt cgcaccccac gccggtgcaa gccccattgt gcccgacagt
     201  ttcccttgcg taccccgtta ttcggacgac atatcccatt tccgtttaac
     251  gttgtcgctt gacttctctg tcccgcgccc gctctttttg aacgcgcgtg
     301  tgcacttgag agcttctacc gacaacccct taccatcgct tccccttggt
     351  ttccacgctg aaacctttgt tttggaattg aacggcagtt cagctccctt
     401  ctctataccg tcccgccaca ttgacttcgt tgtgaaccgg cctttctccg
     451  tgttccctac tgaagtcctc tccgtcagtt cccttcgaac accttctagg
     501  ttgttcgctc ttttatgcga ctttttcctt tactgttcca aaccaggtcc
     551  ttgcgttgaa attgcttctt tttcaactcc accaccctgt ttagtttcga
     601  actgcgttgc acaaattccc acgcacgccg aaatggaaag tattcgtttt
     651  ccaacgaaga ctcttccagc tggtcggctc ttacagttcc acaaacgaaa
     701  atacacgaaa cgacctgaaa ctctaatcat acacgagagc ggcttggctc
     751  tcaaaaccag cgcgttaggt gttacatcga aacctaattc gcgccctatc
     801  accgtgaaat ctgcttccgg tgaaaaatat gaagcttacg agatctctcg
     851  taaagacttc gaacgctccc gcaggaggca acaaactcct cgcgttcgtt
     901  ctcacaagcc ccggaagata aataaagctg tcgaaccttt cttctttcca
     951  gaagaaccaa agaaagacaa acggaagaga gcttctcttc cgactaaaga
    1001  tgaaggtttc attacttttg ggaccttgcg ctttccgctt tcggaaaccc
    1051  ctaaggaaga acctcgtctt cctaaatttc gggaagttga aattcctgta
    1101  gtcaagaaac atgctgtacc agcagtagtt tctaaaccag ttcgaacgtt
    1151  tagaccggtc gctaccactg gcgctgagta tgtcaacgct cggacccagt
    1201  gttcgcgccg tccaagaaat catccgattt tacgcagtgc ttcttatact
    1251  ttcggtttta agaaaatgcc gctccagcgt ttcatgaaag aaaagaaaga
    1301  ttactacgtg aagcgctcta aggtcgtgag tagttgtagt gtaactaaaa
    1351  gtcctttgga agctttgacc agcatactaa agaacttacc acggtattcc
    1401  tacaactcag aacggttaaa attttacgat cattttatcg gcgacgactt
    1451  tgaaattgaa gtgcatccgc tgcgaggcgg caaattaagt gtgcttctta
    1501  ttttgcctaa gggcgaagct tactgcgtag tcactgcggc cacgccgcag
    1551  taccacgctg ctttaactat tgcgcgtggc gatcgtcctc gcgttggtga
    1601  acttctgcag taccgacccg gcgaagggtt atgttacctc gcccacgctg
    1651  ctctttgttg cgctcttcag aagcgcacct ttcgcgaaga agacttcttc
    1701  gttggtatgt acccgacgaa gtttgtcttc gctaaacgac tcactgaaaa
    1751  gttgggtcct agtgctctca aacatcctgt gcgcggaaga caagtctctc
    1801  gttcactctt ccactgtgat gtggcttctg ctttttcgag ccccttttac
    1851  agtttgccgc gtttcatcgg cggcgtggaa gaagaagctc ctgagatcac
    1901  gtcgtctctt aagcacaagg cgatcgaatc ggtctacgaa cgtgtcagca
    1951  ttcacaaaga caacttgttg gctcgtagcg tggaaaagga tttgatcgac
    2001  tttaaagacg aaatcaagtc gctgtcgaaa gaaaaacgtt ccgttaccgt
    2051  ccccttctat atgggggagg ccgtacagag tggtttgacg cgcgcgtacc
    2101  ctcagtttaa tttgagtttc actcacagtg tctattcgga ccaccctgcg
    2151  gcggccggtt cccgtctgtt ggaaaacgaa actttagcct cgatggctaa
    2201  atcttccttt tctgatatag ggggctgccc actttttcac ataaagaggg
    2251  ggagcacaga ttaccacgtg tgcagaccga tttacgacat gaaggacgct
    2301  caacgaagag tttcgaggga actccaagcg agagggctgg tggaaaacct
    2351  ttcccgcgaa caacttgttg aagctcaggc gcgcgtttcg gtgtgccctc
    2401  acactctcgg caattgtaac gtgaaaagcg acgtgctaat catggtgcag
    2451  gtttacgacg cttctttgaa cgaaattgcg tcggcgatgg tcctaaagga
    2501  atcgaaagtc gcttacctca ccatggtgac tccgggtgaa cttctagatg
    2551  aacgtgaagc cttcgctatc gacgctttgg ggtgcgacgt cgtcgtggac
    2601  acccgccgag acatggtgca gtacaaattc ggctcatctt gttactgcca
    2651  caaactgtcg aatataaaga atataatgtt gactcccgca ttcactttca
    2701  gcgggaatct tttttcggtc gagatgtacg aaaaccgaat gggcgtcaac
    2751  tactacaaaa tcactcgttc agcgtattct cctgaaatac gcggcgttaa
    2801  gacgctgcgg taccgccgag cctgcaccga ggtcgtgcaa gttaaactgc
    2851  cacgcttcga taaaactcta aagacgtttc tctccgggta tgattacata
    2901  tatttggatg cgaaattcgt ctctcgagtc ttcgattacg tggttagcaa
    2951  ctgtagcgtt gttaacagta aaaccttcga gtgggtgtgg agttacataa
    3001  aatcaagtaa atcgcgcgtt gtcataagtg ggaaagtgat acatcgagat
    3051  gtgcatatcg acctcaaaca ctctgaatgt tttgcggctg tgatgctcgc
    3101  ggttggggtg cgttctcgca caactactga atttttagcg aagaacctca
    3151  attattacac tggcgatgct tcgtgctttg agactatccg tttcctcttt
    3201  cgggagtgga gccggagggc ttacgcggaa ataaatcgca gttttcgaaa
    3251  gcttatgaag agcattcttt ccgctgggtt agattacgaa tttctcgatc
    3301  ttgacaactc gctccaacac ttgcttgaat actcagaggt tgaagtgcgc
    3351  gtttcaatcg ctcagaatgg tgaggtggat tgcaacgaag agaaccgtgt
    3401  tttgacggag ataatagccg aagcagcgga caggaaatcc atcgctcaag
    3451  gtctcagcgg agcgttgagc tccgttccaa cgcaaccgag aggcggtctg
    3501  agagggggta gtcgccgaag tggagtttct ttcctttata acttggtaga
    3551  ggaagtcgga aatcttttct tttccgtcgg tgatgccgtg cggtttcttg
    3601  ttaaggtatt taaaactttt tccgactctc ccatctttcg ggtcgttcgg
    3651  atgttcctgg acttggcgga agcagcttca ccgttcgttt cggttgtttc
    3701  tttgtgcgcg tggttgcgcg aagctgtaag cgctttctca agctgggttg
    3751  ccgacagaac ggtgtcggaa agtgtaaaaa cctttgtaaa ccgtacggta
    3801  aaaaggtttc taaactttat gtctgcaaaa accctgacga aaaaattttt
    3851  taggtttttc ttatccgctt ccgccttagc taaaaccgtt gtgaggaagg
    3901  cgaaggtgat tttggaagct tactgggaag tgtggttcga atcgattctt
    3951  tcggatagtg gagagtatag tgctgttgaa ttttgtagca gcgttgtgat
    4001  cacactgtta acgaattccg gtcggctgct acctgggttt agtccatccg
    4051  ctgtcattac tgaagtactg cttgacctag ccacgaaaat atccattgaa
    4101  gttcttctaa aacaaatttc tcctgtcgac tcgacagctt cttcggcctt
    4151  atatcgccgc gtcctaagcg agattctgtc gaattttcgc acaatgggcg
    4201  aacacgggat cttcactaaa gtctttttac tctgcgggtt tctacccgtg
    4251  tttgttagga agtgcgtcgc tctgtgcgtt cctggtgaca tggcgacgta
    4301  cgcccggttt ctcgaatacg gggtcgacga tctcttcttt ttgggaaggt
    4351  ccgtgaactc gattaagaac tacctatgtg tggttgctgc cgggttggtg
    4401  gactccattg tcgattccgt tgttttgaaa ctttccggtg tcgccaaaga
    4451  gcgagtgctt ggttttaaat caaaaatcat aaaaaatttt ttaaacgtct
    4501  ttaggaaggc gaaagtcgtt acacgtactt cttccagcac ggacttgtcg
    4551  gaagacgaat atttttcgtg cgacgaaagc aaacccggct tgagaggcgg
    4601  ttcctctagg ttcacgcttt cgcgattgct tgacatcttt ttcaatttcc
    4651  tgaaaagttc aaagctcgtc atagagaatg cgtgcttttc tgcttacgaa
    4701  aggattgaaa ggaacatgaa actatacttt tttcctttaa attcttcgga
    4751  agaagaagct cgccgcttaa ttcggtgcgc gggagacttc gactacttaa
    4801  gcgatagcgc tttcgacgaa gatgaaatgt tacggcaagc tttcgaacaa
    4851  tactattcca gtgacgacga gagtgtaact tacgatggaa aacccacagt
    4901  tctccgtagt tacttgaacg tgagtagaag gttcttggaa acgttctgta
    4951  acggcccgaa gtttttcgtc aaagtttcga attactttaa agcgctgtat
    5001  agtcgtttgc tccgtgttct accgtgggta gacagaaatc tttctgactc
    5051  gccaggactt aaaggaggta acgagaaagc tcttcttgcg aagttcctta
    5101  aaacctgcgt cataaccgct tgcgaatgtg tgtcgcagat atgctgcctg
    5151  cgtcttattc gcttatgttg ggggacacca gcgtgtggtt tagttaggtt
    5201  attttacata acttattccg gtactcgcgt gttgtcgcgt gttgtggtcg
    5251  cggtggctgt atgccctctt ttggtcagaa acgaactgga tggcttgagt
    5301  gatggattaa ccaacatggg cgtttcggtt tttcgtcgct tgttcgtcgc
    5351  ccttcggcgc gcgctttcgg cgtactctaa ttccgcccta cgacggaaga
    5401  ttttcgaatt cattttcgga aacattcacc acccttttga tgtcgcagta
    5451  atcgaaacaa acgaagttgc gccggaacct ctttcaccgg aagtggacat
    5501  tgatgtcgac tgcgactttg gttccgattc agaatcggtt tcttcagatg
    5551  aagtcgcgtc gattccccgt ccaggcttac acggtgggag taggcgctct
    5601  tccaactttc taacctctct cgtgaaggtt gtttttaagt tggctgggcg
    5651  cattccgcgt ttgcttttcc gtttacgcaa ttttgtggcg tactttgttg
    5701  aacgacggct ggcttcaaaa aggttgaaga cgttcatcgg tctggccagg
    5751  ctgtttgata atttctcact cacttcggta gtttaccttc tccaagagta
    5801  cgattcagtg ctgaacgcat ttatagacgt tgagctagtc ctacttaact
    5851  cgggtagcgt gaatgtgcta cctttagttt cttgggtcag gggatctcta
    5901  acgaagttag cggaagtgat cgttggttca ggcttcgctt cgtttctagg
    5951  aaggatgtgc tgtcgtgtgt ccgactggtg ctcctcgtct tcgaacgccg
    6001  gttgtaactt tatgagtccg gttcgtacga aagggaagtt cgttccccct
    6051  tcgtcttccg gttcaaccgc ttcgatgtat gaacgtctcg aagctctcga
    6101  gagcgatatc cgcgaacacg tgctttccac gtgtcgtgta ggaagcgacg
    6151  aagaagaaga aaggccgaaa gaagtgacag aaccaggaat tgaacatact
    6201  tctgaagatg ttgttcccat tcgttcacac tcgcaaccct tatctggagg
    6251  tgaatgttcg tattctgaag atcgtgaaga gaatgaacga gcgaacctgt
    6301  taccgcacgt tagcaaaatc gtcagcgaac gaaggggttt ggagaccgcc
    6351  cgtcgaaaca aacgtactct acgtggtgta agcgagtttc tcaacgctat
    6401  taatactagc aatgagcaac ctaggccgat aatcgttgac cactctcctg
    6451  aatctcgcgc gttgaccaac tccgtgaggg aattctatta cctccaggaa
    6501  ctcgctcttt ttgagttgag ttgcaaactt cgtgagtatt acgatcaatt
    6551  gaaggttgcg aattttaaca gacaagagtg tttgtgcgac aaagacgaag
    6601  acatgtttgt tctacgagcc ggacaaggtg tagtttccgg cagaaactcg
    6651  aggttgcctc ttaagcattt caaggatcac gaattttgtt ttcgctctgg
    6701  agggttggtc ccttacgacg gtaccagcag agtggacacc atttttcaca
    6751  cgcaaacgaa tttcgtttcc gcgaacgcgc ttctttcggg ctatctctcc
    6801  tatagaactt tcactttcac taatttgagc gctaacgtac tgctgtacga
    6851  agctcctcca ggtggtggaa agaccacgac tttgataaag gttttttgtg
    6901  aaactttttc aaaagttaat tcgctgattt taacggcgaa taagagttcg
    6951  cgagaagaaa tacttgcgaa ggtgaatcgc atcgtacttg acgaaggcga
    7001  tacgcctctt cagacgcgtg acaggatttt aactatcgat tcttatctaa
    7051  tgaacaacag aggtttgacg tgtaaggttt tgtacctcga tgagtgtttc
    7101  atggttcacg ctggagctgc tgtagcttgc atcgaattca ccaaatgcga
    7151  ttcagccatc ttatttggag acagcaggca aattcactac atagaccgta
    7201  acgaattgga tactgctgtt ctttcagatt tgaaccgttt tgtcgatgat
    7251  gaatcgagag tatatggtga agtctcatac aggtgtcctt gggacgtttg
    7301  tgcttggttg tcaactttct acccgaaaac tgtggccact accaacttgg
    7351  tttcagccgg tcaatcttcg atgcaagtac gcgagattga aagcgtagac
    7401  gacgtcgaat attccagtga attcgtctac ttgactatgt tacagtcaga
    7451  gaagaaagat ctgctgaaat ctttcggcaa gaggtctcgt tcgagcgttg
    7501  agaaacccac ggtcttaaca gtccatgaag ctcaaggtga aacctaccgc
    7551  aaagttaacc tcgtcagaac gaaatttcaa gaggacgatc cttttcgtag
    7601  cgagaaccac atcacagtgg ccttgtctag gcatgtcgag agtctgacct
    7651  attcggtcct gagtagtaaa cgtgacgacg caatagctca agctatagtg
    7701  aaggcgaaac aacttgtgga tgcctatcgc gtttacccca cgtcatttgg
    7751  tgggagtact cttgatatta gtgttaaccc ttctacatct gacaggagca
    7801  aatgtaaagc ttcctctgcc ccttacgaag ttataaacag cttcttggag
    7851  agcgtggttc cgggcactac ttcagtagac tttggggacg tttccgaaga
    7901  gatgggcact caggtttttg agtccggtgc tgataacgtt gttattcgtg
    7951  attccgcacc tgttaacaag tcgacggatc acgacccgca gcgggtttag
    8001  ctcgattcgc tcgcaggcga ttcctaagag gaaaccgtcg ctgcaagaga
    8051  atttatactc ttatgagtcg cgtaattaca actttaccgt ttgtgaacgt
    8101  ttttccggac cgcaggagtt cggacaggcg atggcgatgg ttatgttgga
    8151  acgaagcttt gacttagaga aagttgctaa agttagaagc gatgtgatcg
    8201  ccataacaga aaaaggggtg cgaacatgga tgtcaaaacg tgaaccttct
    8251  cagcttaggg ctcttagtag tgacttacaa aagcctctaa acttggaaga
    8301  ggaaataacg acttttaagt tgatggttaa gcgggacgcg aaagtcaaac
    8351  tcgattcgtc gtgtttggtg aaacacccac cagcgcagaa tataatgttc
    8401  catcgcaagg cggtgaacgc gattttctcg ccgtgtttcg acgagtttaa
    8451  aaatagagtc attacctgta cgaattcaaa tattgttttc tttaccgaaa
    8501  tgactaactc tactctcgcg tcgatagcga aagagatgct ggggagcgaa
    8551  cacgtttaca acgttgggga aatagacttt tcgaaattcg acaaatccca
    8601  agacgctttc attaagtcgt ttgaacgaac cttgtattca gcgtttggtt
    8651  tcgacgaaga cctgcttgac gtgtggatgc aaggtgaata caccagcaac
    8701  gctacaactc tggacggtca actttctttt tccgtcgaca accagaggaa
    8751  atcgggcgct tctaatacgt ggattggtaa ttccatcgtg actcttggca
    8801  ttttgagcat gttctattac accaatcgat ttaaggctct tttcgtgtcc
    8851  ggggacgact ctttgatttt ctccgaatct cctattagaa attcagccga
    8901  tgcgatgtgc acagaactcg gttttgagac taagtttctc actccgagcg
    8951  tcccgtattt ctgctcaaag tttttcgtta tgaccggtca cgacgttttc
    9001  ttcgtgcccg acccttataa acttttagtg aaattaggag cttctaagga
    9051  tgaagtggac gatgagtttc tgtttgaagt gttcacctct tttcgcgatt
    9101  taacgaaaga tttagtcgat gaaagagtga tcgaactctt gacgcatttg
    9151  gttcacagta agtacgggta cgaaagtggt gatacgtacg ccgccctgtg
    9201  tgctattcat tgtattcgtt caaacttttc atcgttcaag aaattgtacc
    9251  ctaaagttaa gggctgggtc gttcactacg gtaaactgaa gtttgtgctg
    9301  cgcaaattcg cgaactgttt tcgcgagaag tttgacactg ctttcggcga
    9351  agcgtacttt cttacttacg acgaaacttg agactgtgtg gtaactcggt
    9401  tgttgttttg tttgtttgtg tgtctgtagt cctacttcgc ggtgatggac
    9451  tgtgtactcc gctcgtattt attactcgca ttcgggtttt ggatttgctt
    9501  gtttcttttc tgcttagtgg tttttatttg gttcgtgtat aaacaaatac
    9551  tttttcgaaa caccccgcct tcgaacgaag cgcgtttcaa ccgttccacg
    9601  gtcgtgtgat ggttgttttc ggattagatt tcggcactac tttctcgagc
    9651  gtttgcgctt atgttggaga agaactctat ttgttcaaac aaagagatag
    9701  tgcttacata cccacttttg tgtttttaca ttccgatact caagaagtgg
    9751  ctttcggtta cgatgccgaa gttctttcta acgacccttc ggttcgtgga
    9801  gggttctatc gcgacttaaa acgctggata ggatgtgacg aagagaatta
    9851  cggggattac ctggaaaaac tcaagccgca ctacaagacg gaattgctta
    9901  aagttgcgca aagttcgaaa tccaccgtga ggttagactg ttactcaggt
    9951  accgtgccgc agaacgccac tctaccgggt ttgatagcga ctttcgtcaa
   10001  agctctcatt tccacagcca gtgaagcttt caagtgtcag tgcaccggcg
   10051  ttatttgttc ggtccctgcc aactataact gtctgcaaag gtcttttacc
   10101  gaaagctgcg tcaacctaag cggctacccc tgtgtttaca tggttaacga
   10151  accgtcggct gcggcgctct cagcttgttc cagaatcaaa ggcgctactt
   10201  cgcccgttct cgtgtatgat ttcgggggtg gaacgtttga tgtttccgtg
   10251  atttcagcgc tcaacaacac ttttgtggtg cgcgcttctg ggggcgacat
   10301  gaatttggga ggtcgtgata tcgataaggc ttttgttgaa cacttgtaca
   10351  aaaaggctca actgcccgtg aactacaaaa ttgacatttc cttcttgaaa
   10401  gaatcgctct caaagaaggt ttccttctta aacttcccgg tggtcagtga
   10451  acagaacgta aaagttgacg ttttggttaa tgtcagcgaa ctggctgaag
   10501  tggcggctcc tttcgtagaa agaacgatca agatcgttaa agaagtttac
   10551  gaaaaatatc gtggtagcat gcgattggaa ccgagtgtta aagctaaact
   10601  gcttatggta ggtggttctt cctacttgcc aggtctttta tcgcgtcttt
   10651  cctccgtgcc tttcgtggaa gaatgccttg tgctgcccga tgctcgagcg
   10701  gcggttgccg gggggtgtgc tttgtactca gcttgtcttc gaaacgattc
   10751  tccgatgtta ctggtcgact gtgcagctca caatcttagc attagtagca
   10801  aatattgcga atccatcgta tgcgttccgg ctggtacacc catcccgttt
   10851  acgggagttc gaacagttaa catgactggt tccaacgctt ccgctgttta
   10901  cagtgcggcg cttttcgaag gagacttcgt caaatgtcgc ttaaacaaaa
   10951  ggattttctc tggtgacgtc gccttaggaa acgtcggggt gtccggttca
   11001  aacactagga cggtcccgtt aacactcgaa attaatgttt cgagcgtcgg
   11051  aacaatcacg ttttccctcg tcggaccgac aggtgttaag aagttggtgg
   11101  gtggaaatgc tgcttacgat ttctcgagtt atcagctcgg ggagcgcgtc
   11151  gtcgcagact tgcacaaaca taattctgat aaagtgaaac ttattcatgc
   11201  gttgacgtat aagccttttc aaaggaagaa attgactgaa ggcgacaaag
   11251  ctttgttctt aaagagacta agtgcagact accgacgtga agcgggaaag
   11301  ttcagttcat atgacgacgc ggttctcaac tccagcgaac tactactggg
   11351  gagagttatt ccgaagattc ttcgggggtc gagagtggaa aaacttgatg
   11401  tctgaagctg cttcggttag gcggcctgtg tatgatcgcg actttcgttt
   11451  ttcaaacggt gaagtattaa gtcgcaagaa tttcagcgac tcaaccggcg
   11501  aatcatttgt gcgtgagttt tcattgctgc tgactttccc aaagacttat
   11551  gaagtttgca agttatgcgg tgtggctatg gaacaagctc tgagcggcat
   11601  gaatcgtcta tccgattata acgtctccga acttaacgtc gtcgacgtga
   11651  aaaccgtggg ttgcaaattt aatatacaaa ccgtcactga attcgtgaga
   11701  aagctcaacg ggaatctggc cgaaccttct ctcgtcgagc actgttggtc
   11751  tctgtctaat tcttgcggcg aactgatcaa tccgaaagac acgaagcggt
   11801  tcgtttccct catctttaaa gggaaggacg tcgtcgaaag caccgacgaa
   11851  gccgtagttt cctcttctta cttagattac ctttcccact gtttgaactt
   11901  gtacgaaacg tgtaatcttt cgtctaactc agggaagaaa gctttgtacg
   11951  acgaatttct aaagtacgtg atcgtttatc ttgaaactag tgacttagaa
   12001  taccgttcac tttccgacaa ccctttggtt gccggtgttc tttacgatat
   12051  gtgttttgaa tataacacgc tcaagtcgac gtacctaaag aacatagagt
   12101  cattcgattg ttttttgagt ctgtacttac cgttgctcag tgaaatcttt
   12151  tcgatgaatt gggaacaacc agcgcctgac gtccggttgc ttttcgaact
   12201  cgatacaacc gaacttcttt tgaaaattcc gactatcaac acgcacgact
   12251  caactttttt gtataagaat aagttgaggt atctggaatc ctactttgaa
   12301  gacgactcta atgagctcat aaaggtgaaa gttgattcac tcttaacccg
   12351  agacaatccc gaactgaaac tagctcagag gtgggtaggt ttccattgtt
   12401  actacggggt ttttaggacc gctcagacta ggaaagtgaa aagagatgcg
   12451  gagtacaaac tgcctccagc tctcggtgaa ttcacaataa acatgagtgg
   12501  agtggaagaa ttctttgatg agctgcagaa gaaaatgcct tccgtttctg
   12551  ttcgtcgcag attttgtggc agtttgtctc acgaagcttt ttcgattttc
   12601  aagagattcg gggtgggttt tcctccgatc actagattaa acgttcccgt
   12651  gaaatactcc tatctaaacg ttgactatta cagacacgtg aagagagcgg
   12701  gcttgacgca ggacgagttg actattctca gtaacatcga attcgacgtc
   12751  gctgaaatgt gctgcgagag ggaggtggct ttacaagccc gtcgcgctca
   12801  gcgcggcgaa aaaccatttc agggttggaa aggtgttaaa aacgaagttt
   12851  ctccgcacgc gcgttcctca attcgagtga aaaagaacaa cgaatcgtta
   12901  ctaaacgttt tgtggaaaga tgttggcgcc cgaaggcagg ggagacttaa
   12951  tccacttcac cgaaaacact agagatgcca tggaaacttt cttcaacagc
   13001  tacgatttag ctgaatactc cgaagtgaac cctaacaaac ttaatcggaa
   13051  agagaccgac gagttgttag gtgttattcg agagagattt aaatccgaat
   13101  tggtgataac agatgaagat tttgtgaaac atttagcctt cgcgttgatt
   13151  cgcgcggcca atatcaccac tagtacgaaa gtcaactacg tcggggcgta
   13201  cgagtatacg atagggggaa agaagttcct ggtcaaggac gcttgggttt
   13251  tccctttgat aaaggagtgt atgaaaaagt tcaacaaacc caatcctgtg
   13301  aggacgtttt gtgctacttt cgaagacgct tacatagtga tagctcgttc
   13351  gttgcctaaa ctgttcctga atagaaccat tggcaaacgt gggatcccgt
   13401  cagggtatga gttcctcggg gcagattttc taactgcgac cagcgtgtgt
   13451  ttgaacgatc acgaaaaagc tatcgtacta caggcctcaa gagctgccat
   13501  tgatagagca gtctcttcgt cggtcgacgg gaagatcgtc agtcttttcg
   13551  acctcggtcg tcttagttaa cacagttact aaggttccat tttattattg
   13601  cattgttttt catttagtgt aatcgtactt gagttctaat atgggatcag
   13651  ccgaacctat aagtgcaatc gcgacttttg aaaacgtgag tctcgtagac
   13701  caaacgtgtt tgcacggtga agactgcgac aaactacgga ggaatttcga
   13751  agagtgtttg aaattgaaag gggttccgga agataaactc ggtctcgcgt
   13801  taggactttg tttgtactcc tgtgcgacga taggtacttc taataaagtt
   13851  agcgtccaac cgacgtctac tttcatcaaa gcttcgttcg gtagtgggaa
   13901  ggaattgttc ctcactcacg gcgaactgag gtcctttctg gactctcaga
   13951  aacttttaga gggaaagcct aacaaattgc ggtgtttctg ccgcactttt
   14001  cagaaggatt acatatcctt cgcgaaggaa taccgaggaa gactgcctcc
   14051  gattgctaga gccaaccgtc acggtctacc tgctgaagat cactacttag
   14101  ctgctgattt catatcgaca tcaacagaac ttactgacct acaacaaggt
   14151  cgtctgctgt tggcgcgcga aaacgccact cacacagaat tctcgtctga
   14201  atcaccagta actagtttga aacagctggg tcgtggtcta gccaccggaa
   14251  aatgactagc tctgtcgaac tagctcagac gaaacccctt tttagagtgt
   14301  tgctattaaa gggtttcgtt ttttatattg ttgcaatcga aacagaagaa
   14351  gaatcgcctg aagttgaact tcctttggtt tacctccacg atctcgagtt
   14401  gaatgttaac aaaaagggga agatcgaatc ttcgtacatc gactttaaat
   14451  cttgtatgac taggttgaaa cccagttcgg tctcttacac tcgagtgagt
   14501  tctgggaaac cttcagaaga tttctcttcg tcatactcag gaaaaacttt
   14551  cgattcaaaa atacttaacc gtaaagtgac gtttacattc gaaagtggaa
   14601  ttcaactcgt gttcgggatg tacggtcgcg atcagcggtg tgtctcttcc
   14651  gaatacttgt ggtttgaaaa cgtattcgtc ggcgcgcact gcggcacctt
   14701  accctattgt ctgaattgcg aattagacaa aagcggtggt gaattggaaa
   14751  ttttgacttt ttcaaagaat gaagtttttc tttaatgact gtgaaacttc
   14801  tcgagccata tctaggtctg aatcgctcct acgtcgcgtg aaggaacttg
   14851  gaacgaactc gccgcaaagc gaggtctctg agtgcatcaa cgaattcaac
   14901  gaactagcaa ggtttaatca cttgttagtt acggtcgaac acagggaacg
   14951  gatggaaaaa catccgaaac agtcgtcgga acttcgaact ccatcacgac
   15001  ttggcgaaat gctcaaagaa attcgtgcgt tccttaaggt gcgcgtggta
   15051  acccctatgc ataaggagac tgccagcgaa actctgaacg cgtttctgga
   15101  agagtactgc cggattactg gactcactcg cgaggatgcc ttgcgagaaa
   15151  aaatgaggaa agtaaggagt acggtgctgt tccatcactc ggaacttttg
   15201  aagttcgaag tgactgaaaa catgttcagt tttactgaac tactaaaact
   15251  aaatctaagc ttgagggtga tttcttctca aatcctcggt atagctgtat
   15301  agagaagtga cggaggtgac ctacctaccg tgtaatttaa gtcgtcacag
   15351  agtgacaacg gcaccaagtg gtgctttgtg cgtatgtaaa ttgcgaagtg
   15401  aaaaaatttt ttaaaaaaat ttttcacact cctagcgaag tcccgctagg
   15451  aagaaaaaat aagggccg