!!NA_SEQUENCE 1.0
ID   AF104335   standard; RNA; VRL; 3588 BP.
XX
AC   AF104335;
XX
SV   AF104335.1
XX
DT   04-MAY-1999 (Rel. 59, Created)
DT   28-JAN-2000 (Rel. 62, Last updated, Version 2)
XX
DE   Broad bean wilt virus 2 RNA2 unknown gene, complete cds.
XX
KW   .
XX
OS   broad bean wilt virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Fabavirus.
XX
RN   [1]
RP   1-3588
RA   Lee U., Lim P.O., Choi J.K., Nam H.G.;
RT   "Analysis of nucleotide sequence of broad bean wilt fabavirus RNA 2";
RL   Unpublished.
XX
RN   [2]
RP   1-3588
RA   Lee U., Lim P.O., Choi J.K., Nam H.G.;
RT   ;
RL   Submitted (03-NOV-1998) to the EMBL/GenBank/DDBJ databases.
RL   Life Science, Pohang University of Science and Technology, San31 Hyoja
RL   Dong, Pohang, Kyung Buk 790-784, Korea
XX
DR   SPTREMBL; Q9WDH0; Q9WDH0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3588
FT                   /chromosome="RNA2"
FT                   /db_xref="taxon:76875"
FT                   /organism="broad bean wilt virus 2"
FT                   /strain="Korea K"
FT                   /serotype="2"
FT   CDS             596. .3409
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9WDH0"
FT                   /product="unknown"
FT                   /protein_id="AAD28349.2"
FT                   /translation="MSEANITPVHTIPKDTLLKRASDYKLAVESKKSILPKVQDLYEMD
FT                   KWHTLKSKLSKNAPSYVTTSEIAVGAMSGAGNTKLAIPIVEKYTEEVTDDRLPDKVRAK
FT                   ADQIMVAAIELVADGFASVNSDVTMAGALYDKRHKTIASSFKGAFASRASGVPSHVIYF
FT                   PMHRVPASDDPNTTLELSMVSRDSDFDEGYTLANISARTLYVRAKGPEKVTETRHLLKA
FT                   KTEDVVKARQFASEAQVVFRTPRLFPEVNLDNYNLPGPSNVQQSEAITTDRGIFFPKPK
FT                   FKGNEVVLNYTGPAKINTHGSQRFEKKDSSSGQFVRNVEDLGCLSDEEDGKDYRYGQGL
FT                   MEEDVLNVQTNTFAIESATETMRLLFSGYASIPLNVIPGTKITVAYLNELSKHSAVHTG
FT                   LLNMLSKVPGSLKVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLGIQHYKWNPA
FT                   IEPFVEFVFKPFSCADWWNMHYLGSLKYAPVVVIQTLSKWLNAPKVDARISFAIYYEPS
FT                   IVLPKQIATLEHAPAFMFRKELGTLAFKQGERVAYSFEVNFGKPQTDGKEVISTFASSY
FT                   CGLSQYMQSDVILDFTLMSSPMIGGTFSIAYVAGAYIEKIGNMQVLDSLPHIDFTFSAG
FT                   SKSTRSVRFPKEVFGVYQALDRWDLDSARGDDVSGNFVLYQRDTVSSALEGELTFRIAA
FT                   RLSGDINFTGVSAGYPTTITRIGKGKTVGRSLDPEIRKPLRYMLGQAHATPKDFSSVRF
FT                   VMGRWKYKAGLYPGSKSDEDIHPFSLKMRLDGSKSSENFEIIHSPFVRLLQNCAWMRGT
FT                   LKFYIVARASSDYMSYRRTSQLTVSAHENSLSSNQFYSGVLTSPSGELSFSREVVGPVD
FT                   GFASMGWNVRGSKKFYKIHVEMGNVHEYDTVVLYGQFGSDVEFAGQQKGGHYLLEKETP
FT                   VFKTIKY"
XX
SQ   Sequence 3588 BP; 991 A; 673 C; 844 G; 1080 T; 0 other;

AF104335  Length: 3588  December 21, 2001 14:52  Type: N  Check: 5682  ..
       1  tttcgttccg agaaaacagc tttcagttac caaaacagct ttcggctaca
      51  aaacagcttt cagatacttt ggaattttca aattgaaccc ggaaaaaggg
     101  agtgtgattt aaagcgcacc atatattttg aaaatttcct ttcttttctt
     151  ccaattttgt gttgttcttg ttgacgtatt acacagtcaa atttagtttt
     201  gagtgtgttg taatgcgtcc tgagcttgtt gcagtcttag atagatacgt
     251  ttcagagatc ataagttggt cttttcttgg gttggttaat aaatttgcta
     301  cttgtctggt tttgttctaa aaagtgcttt cttgttgtgg gcagctctct
     351  tgtatgtttc ttattacata ttgagatttg aatttgcata tatcgttgcg
     401  ccctttctta aaacgatata ctcaaacagc tctcaatatc acgttattga
     451  ttgggaaaac gcatacacgg ctgtgcctaa aggtttgtgg gagcaaatta
     501  ctgattacaa ttattgtttc aacttccctc ccccttctac agaaggtttt
     551  gcgtcaattt tttccccgag attcacattg aaagagcttg aaatcatgag
     601  cgaagcaaat atcactccag tgcatacgat tccaaaagac actttgctta
     651  agagagcaag tgattacaaa ctggctgtgg agagcaagaa atccattttg
     701  cccaaagtgc aagacttgta tgagatggat aaatggcata ccttgaagag
     751  caaattgagt aagaatgctc ccagctatgt cacaacgtct gagatagcag
     801  tcggcgcaat gtcaggtgca ggaaatacaa agctggcaat accgattgtc
     851  gaaaagtaca ctgaggaagt gacagatgac agattgcctg ataaagttcg
     901  tgcaaaggct gaccagataa tggttgcagc tattgaatta gtggcagatg
     951  gttttgcctc ggttaattca gatgtgacta tggctggtgc actttatgac
    1001  aaacgtcata aaactatcgc aagttctttt aagggtgctt ttgcatcgag
    1051  agctagtggg gtcccatcgc atgtcattta ttttccgatg cacagagttc
    1101  ctgcaagcga tgatccaaac acaactttgg aactctcaat ggtgagccgg
    1151  gattcggact tcgatgaagg atacacactg gctaacattt cagctcgcac
    1201  tctttatgtt cgtgcaaagg gacctgaaaa ggttactgag acaagacatc
    1251  ttttgaaagc taagactgag gatgtggtca aagcgcgcca gtttgctagt
    1301  gaggcgcaag ttgtatttcg tacgccccgg ttatttcctg aagtaaattt
    1351  ggacaattac aatttacctg ggcctagcaa tgtgcagcaa tcagaggcca
    1401  taacaactga cagaggaatc tttttcccca agccaaaatt caaaggaaat
    1451  gaagtggtgc ttaactacac aggaccagcg aagattaaca cccatggctc
    1501  acagagattt gaaaagaaag attcttccag tggtcaattt gtcaggaatg
    1551  ttgaagatct aggatgcttg tctgatgagg aggatggcaa ggattataga
    1601  tatggtcaag gcttgatgga ggaggatgtt ctgaatgtgc aaacgaacac
    1651  ttttgctata gagtcagcca cggagaccat gcgtttactg tttagcggat
    1701  atgcaagcat tcctttaaac gttatacctg ggaccaaaat tactgtggct
    1751  tatctgaatg agttgtccaa acacagtgct gtccacactg gcttgttgaa
    1801  catgttgagt aaagtcccgg gttctttaaa ggtcaaaatc aattgtcagg
    1851  tggctccaac atgtggtata gggttggcag tcagctacgt tgaaggcaat
    1901  gagagcgcga atctgggctc aagtttggga cgtttgttag gcattcagca
    1951  ctataagtgg aatccggcca tagaaccgtt cgtggaattt gttttcaaac
    2001  ctttttcctg tgcggactgg tggaatatgc actatttggg atctctaaaa
    2051  tatgctcctg tggtggtcat tcagacactg tccaagtggc tgaacgctcc
    2101  gaaagtcgat gccagaatta gttttgcgat ctattatgaa ccttccattg
    2151  tgttgcccaa acagatagcg actttggagc atgccccagc gtttatgttc
    2201  cgcaaggaac tgggaactct ggctttcaag caaggggagc gtgtggctta
    2251  ttctttcgaa gtcaattttg gcaaaccaca aactgacggg aaagaggtaa
    2301  tttcaacttt tgcctcttct tattgtggtc tcagtcaata tatgcaatcg
    2351  gatgtcattt tggatttcac tcttatgagc agccctatga ttggaggaac
    2401  tttctcgatt gcatatgttg ctggtgccta cattgagaag attggaaaca
    2451  tgcaagttct tgattcattg ccccacattg acttcacatt ctcggcagga
    2501  tctaagagca cccgttctgt gcgctttcct aaagaggttt ttggggtgta
    2551  tcaggcactt gatagatggg acttagactc agcaagagga gatgatgttt
    2601  caggcaattt tgtgctttac cagagagata cagtgtctag tgctttggaa
    2651  ggtgaactca cattcaggat agccgcccgt ttatccggag atattaattt
    2701  cactggcgtc agtgcaggtt atccaacaac gataacgcgc atagggaaag
    2751  gcaagactgt aggaaggtca cttgatcctg agatcaggaa acctctaaga
    2801  tacatgcttg gacaagccca tgcaacacct aaagatttta gctcagtgcg
    2851  ttttgtgatg ggccgctgga agtacaaggc aggtttgtat cctgggagta
    2901  agtcggatga ggacatccat ccattctcct tgaagatgcg ccttgatgga
    2951  tctaaaagca gtgagaactt tgagattata cattcccctt tcgtacgcct
    3001  gttgcagaac tgtgcatgga tgagaggcac tctgaaattt tacattgttg
    3051  ctcgtgccag ttctgattac atgagctaca gaagaacatc tcagttgacg
    3101  gtttcggccc atgagaatag tctcagttca aaccaatttt acagtggagt
    3151  tttgacgagt ccaagtggcg agttgagctt ttccagagaa gtggttggcc
    3201  ctgttgatgg ttttgcttct atgggttgga atgttcgtgg gagcaagaag
    3251  ttttacaaga ttcatgtaga gatgggaaat gttcacgaat acgatactgt
    3301  agtgttgtac ggacaatttg gctctgatgt tgaatttgct ggccaacaga
    3351  aaggaggaca ttacttacta gagaaggaaa ctcctgtttt caaaaccatt
    3401  aaatattaat aatttaagta attgtttggt atttgaattc taataaaaag
    3451  gcgagggtca ctagcctccc agcaaaatgg gttccatgac ctttgtttgt
    3501  ttcatttgta atatttacta cttttaaaac acatgtgtgc tgtgttaggt
    3551  taaagcttcc tatatatata tatgctttag tagatttt