!!NA_SEQUENCE 1.0
ID   AF144234   standard; RNA; VRL; 5989 BP.
XX
AC   AF144234;
XX
SV   AF144234.2
XX
DT   12-JUN-1999 (Rel. 60, Created)
DT   22-JAN-2003 (Rel. 74, Last updated, Version 3)
XX
DE   Broad bean wilt virus 2 polyprotein gene, complete cds.
XX
KW   .
XX
OS   Broad bean wilt virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Fabavirus.
XX
RN   [1]
RP   1-5989
RA   Lee U., Lim P.O., Hong J.S., Choi J.K., Nam H.G.;
RT   "Biological, Serological and Molecular Characterization of a Korea Isolate
RT   of Broad Bean Wilt Fabavirus Isolated from Severe Necrotic Symptoms of
RT   Capsicum annuum L. in Korea";
RL   Unpublished.
XX
RN   [2]
RP   1-5989
RA   Lee U., Lim P.O., Choi J.K., Nam H.G.;
RT   ;
RL   Submitted (19-APR-1999) to the EMBL/GenBank/DDBJ databases.
RL   Department of Life Science, Pohang University of Science and Technology,
RL   Hyojadong san 31, Pohang, Kyungbuk 790-784, South Korea
XX
RN   [3]
RC   Sequence update by submitter
RP   1-5989
RA   Lee U., Lim P.O., Choi J.K., Nam H.G.;
RT   ;
RL   Submitted (20-DEC-1999) to the EMBL/GenBank/DDBJ databases.
RL   Department of Life Science, Pohang University of Science and Technology,
RL   Hyojadong san 31, Pohang, Kyungbuk 790-784, South Korea
XX
DR   GOA; Q9WP48; Q9WP48.
DR   SPTREMBL; Q9WP48; Q9WP48.
XX
CC   On Dec 20, 1999 this sequence version replaced gi:5031293.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5989
FT                   /country="South Korea"
FT                   /db_xref="taxon:76875"
FT                   /organism="Broad bean wilt virus 2"
FT   CDS             571. .5880
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9WP48"
FT                   /db_xref="SPTREMBL:Q9WP48"
FT                   /product="polyprotein"
FT                   /protein_id="AAD38152.2"
FT                   /translation="MYQLVFSCEFMEVKEENQELLVGEGRVEEIVDEFLANCNVSERND
FT                   QVSTVINANYAFGQGLYEYATRVSDAIVAVISGSIKKGIDEFLDKVYTTMNQIFAAWMP
FT                   KIRAAFQWFENIKEVVKKWVNTMHEKINCILVGMEDCLYMGAGLVAATCIVTLLEKFMV
FT                   AIGILTKPCGAATLFLTTAMAAISAAYVCSKAVEKSVMLTNLLHFVTSNCQIVLSALFN
FT                   HDATKKELTAIQDGSEAPIGLGQFGVSTMLQDVANLMSTWSTNSVTEIGRTFGAISQIK
FT                   NGILALKDMIYFVFEKLSDLAHKVLGFESQVLADLTILLGENVADWLSECDCMVSYMLE
FT                   FNSRNREIFDRLSQLIEKGRLIRTGVLRTGHRGSSQVMALVTKALEKLIELHNSVVMSG
FT                   SNTTRKSPFMVFFTGASGTGKTSVVQRVAINWLQEEQLGTNEIYSRNGQDPFWSGYKRH
FT                   AVVTYDDFGAVPGTTSNEAEIINVISRNPYATVMAGLAEKGMYFDSRLVLASSNFLAAN
FT                   PESGVHDSEAYERRRHAVIRVSLKPGVPYNANDPCANQTYTLLDSKTPFREKQTFETYA
FT                   ELWSYLYTSFKEHEEQEELYLKSLPILDSDKKEALEGLVGLTVIATSFRPKAVMQYGVD
FT                   KFPGYHFLVSDGEKCYFWHGDGSVESASVEQMQLSKQDVAQLKQQGLSTAMIYKDLAKA
FT                   FPTLNSLAVLYAKNIVVKRWVGPDLEPSKLCKDVYMREQIGNLPKWQRAYLYVLSKYLT
FT                   TQSPRGWFMECLEETKKSLRMTYLWEYKQWPLPLKLALGSLIAIIAGGAIWYSLQSLWC
FT                   MSGDASFVAGAATVFSVSSFAGQSDIPNRDNSERSFRNRKVRARTWQGQSSCFGDSALW
FT                   IAETCMATLTFSNVRTQVCLAPGRGFFGVNHCLAAIPAGVMVKMDSSIGVTYFVWEKEK
FT                   LLQFDGNEIALYMTSTLPKTVDSLLGRIHFDVETLPKTFSAVFFSYKYDPMIQQMVPEL
FT                   GSVTCKVHNKAYTLAHGEYRREIPQSISYEASTVAGDCGSLILAEIDGKFKLVGMHVAF
FT                   NGREGSASFMPYHASLDQKVGQGDFMLKYQEWAEPKILGPGCRAMGLIEPEHALAASGK
FT                   TTFVETPEEWHLDYPCDKLPSVLTRGDPRLAGIIHADYDPFASGMSKYAKEAGPFDAAS
FT                   LKQVCSGIVEIWEDASADFPMDEVDLDTAINGLENVEFFDALVLGTSEGFPYRLDRGPG
FT                   DKGKSRYVSGESGNLKITDEGVLSDISWFEEVSKTQVPDLYCIECVKDERLPIRKVLHE
FT                   PKSRLFTVLPMSYNIVIRKKFLNFVRFFMKRRDVLPAQVGINPYSREWTRMANKLLSKG
FT                   NNILCCDYSRFDGFLPKCIMNEIGDMIAKLMKADEVSKTQIKNLMLACTSRYAMCNRVL
FT                   YRVENGIPSGFPLTVIVNSILNEILVKYAYWHCFEDNPNVQSNFDAHVSMVVYGDDNLI
FT                   SVSDAISSKFDGSFLVSFMEGLGIKVTDGIDKTKVGIEFRRLENCDFLKRSFKMSPDGT
FT                   WRSPMSKESLWPQLHFVKAKKLEMAEAYINNCNNILRELWLHDVREAKEFRNKVLRNLR
FT                   WIGHEQLLNMQQLAVFHSEQMNGVNDFLTACITVDSIPLMDPLVPGMLPVKTCEIVSRI
FT                   FVAAEKHFEGNFSDFFTISITTSRKFEEDKGFVLLFPYGAGRGGLPTTQFMRENVIRKG
FT                   SSIQKKFRQAHEKGNNTLFISQSSVVPAYVFAVMLLHSIGAITRLSSNKALTQAMQTCK
FT                   KLEYLPREYEEFF"
XX
SQ   Sequence 5989 BP; 1703 A; 1023 C; 1518 G; 1745 T; 0 other;

AF144234  Length: 5989  February 4, 2003 13:32  Type: N  Check: 9343  ..
       1  aaatattgaa acaaacagct ttcgttccgg gaaaaacagc tttcagttac
      51  taaacagctt tcgttccgat aaaacagctt tcttttcttc cagaaacaaa
     101  cagctttcaa ttttctttgt tctttgttga ccggaaaatt tagttactgc
     151  gtgactttcc tttcttcttt ggaaagaacc cggaaaaagg cttttgagtg
     201  tgatttaaag cgcaccatat atttcaaaga tcatattgat ttcattttgc
     251  taccttaatt ttaaaatgga tttcaacctc catgcaagtg gttgtgggtt
     301  tttgaagact tcgatgggtt tacaatccat tcgagacatt gtgcagaaag
     351  caaaggtgga tgagaaagac aaaacattgc ttcacatcca cctgtgtttt
     401  ctccatgcca atgagatggc ccgagatttg aacgaaggca tagatgtgag
     451  ccagatacat agctcttcag ctattaagta tcgggccgca attgttacgc
     501  gccatgtgaa gatgaatgtg gaaaccggaa ggtatgatag gaaacgcatg
     551  gtggaataca acaatgaaac atgtatcaat tggtcttttc ttgtgaattc
     601  atggaggtaa aagaggagaa tcaggagcta ctagttggag aaggtcgtgt
     651  ggaagaaatt gttgacgagt ttctagcaaa ctgcaacgtc tccgagcgca
     701  atgatcaagt gtccactgtg ataaatgcca attatgcatt tggccaggga
     751  ttgtatgagt acgcaactcg tgtcagtgat gcaatagtgg cagtgatttc
     801  aggatcaatc aagaaaggca tagatgagtt tttggataaa gtgtacacga
     851  ctatgaatca gatttttgca gcgtggatgc ccaagattag agctgctttt
     901  cagtggttcg agaatatcaa agaggtcgtg aagaagtggg taaacacaat
     951  gcacgagaag ataaattgca ttttggtagg tatggaggat tgcctttaca
    1001  tgggagctgg actcgttgca gctacatgta ttgtcacatt gcttgaaaag
    1051  ttcatggtgg caattggcat ccttaccaag ccttgcggag cagcgacttt
    1101  gtttttgacg actgctatgg cagctatttc tgccgcatat gtatgttcca
    1151  aggctgtgga gaagtcggtt atgcttacca atttgctaca ctttgtgact
    1201  tccaattgcc aaattgtgtt gagcgcttta ttcaaccatg atgcgacaaa
    1251  gaaagagttg acagcgatcc aagatggaag tgaagcacca ataggccttg
    1301  gccagtttgg agtttcaacg atgttgcaag acgtggcaaa cttgatgtca
    1351  acgtggtcca caaattcagt cactgaaatt ggaagaacat ttggtgctat
    1401  ctcgcagatc aagaatggta ttttagcctt gaaagacatg atttattttg
    1451  tgttcgagaa gttgagtgac ttagctcata aagtgttggg ctttgaatct
    1501  caagttttgg ctgatctcac aattcttttg ggtgagaacg ttgcagattg
    1551  gttgtccgag tgcgactgca tggtctctta tatgcttgag tttaactcaa
    1601  ggaataggga gatatttgat aggctctcac aactcattga gaaaggcaga
    1651  cttatacgca caggagtgtt gaggacaggc catcgtggct cttcgcaggt
    1701  catggcactt gtcaccaaag ccttagagaa gctgatagag ttgcacaatt
    1751  cagtagtgat gtctggatcc aataccacta ggaaatcccc ctttatggtt
    1801  tttttcacag gtgcttcggg tacagggaaa acttcggttg tgcagagggt
    1851  agccatcaat tggttgcagg aggaacaact gggcacaaat gagatatatt
    1901  cgcgcaatgg gcaggaccct ttttggtcag gttacaagag acacgcagtt
    1951  gtcacgtatg atgattttgg cgctgttcca ggtacaacct cgaatgaagc
    2001  tgaaattatc aatgtgatat cgagaaatcc atatgccaca gtcatggcag
    2051  gattggcgga gaaaggcatg tacttcgatt cgagattagt tctagctagt
    2101  agtaattttc tggctgctaa ccccgagtca ggagttcatg attcagaggc
    2151  atatgaacgg cgcagacatg cggtcattag agtttctctt aagcccgggg
    2201  tgccttacaa tgcaaatgac ccatgtgcca atcagacgta cactttgctt
    2251  gactctaaaa caccttttag agaaaagcag acatttgaga cttatgcaga
    2301  attgtggtct tatctgtata caagcttcaa ggaacatgaa gagcaggagg
    2351  aattgtacct gaaatctttg cctattttgg attcagacaa gaaagaagct
    2401  ttggaaggcc ttgtgggtct cacagtaata gctacttcat ttcgacctaa
    2451  ggcagtaatg caatatgggg ttgataaatt cccaggttat cattttttgg
    2501  tttcagatgg ggagaagtgc tatttctggc atggggatgg ttcagtagag
    2551  agtgctagcg tggagcagat gcaattgagt aagcaagatg tggcgcaatt
    2601  gaagcaacaa ggattgtcga cagcgatgat atacaaagac ttggctaaag
    2651  ctttcccaac tttgaattcg ttggctgtgt tgtatgccaa gaacattgtg
    2701  gtgaagcgtt gggtaggacc tgatttggag ccctcgaaac tttgtaagga
    2751  tgtctacatg agagagcaaa taggcaattt gccaaaatgg caaagggcgt
    2801  atttgtatgt gcttagcaag tatcttacaa ctcaaagtcc acgtggctgg
    2851  ttcatggagt gtttagagga aacaaagaaa agcttgagaa tgacctattt
    2901  atgggagtac aagcaatggc cattaccttt gaaattggct ttgggttctt
    2951  tgatagccat catagcaggc ggagcgattt ggtattcact tcaatcttta
    3001  tggtgtatgt caggagatgc ctcttttgtg gcaggagcag caacggtttt
    3051  ctcagtttcc tcatttgccg gacaaagtga cattcctaac cgagataact
    3101  cagagaggtc gtttagaaac aggaaggtgc gtgctaggac atggcagggt
    3151  caaagttcat gctttggaga ttcagcttta tggatagccg agacctgcat
    3201  ggcgacacta acattttcta atgttaggac gcaggtgtgt ttggcccctg
    3251  gcagaggttt ttttggagtg aaccattgtc tcgcagcaat tcctgcagga
    3301  gttatggtga aaatggactc tagtatcgga gtgacctact ttgtgtggga
    3351  gaaagaaaag ttgctgcagt ttgatggtaa tgagattgct ttgtatatga
    3401  cgagcacttt gcccaagaca gtagattctc tcttagggag gattcacttt
    3451  gatgtggaaa ctttgcccaa gactttcagc gctgttttct tttcttacaa
    3501  gtatgatccg atgattcaac agatggtgcc tgagcttggg agtgttacat
    3551  gcaaggtcca caacaaggcc tacacacttg ctcatggtga gtacagaagg
    3601  gaaattcccc aaagtatttc atatgaagct agcaccgtgg caggagattg
    3651  tggttctttg atattggcag agattgatgg caaattcaag ctcgttggca
    3701  tgcatgtggc tttcaatgga agagagggaa gtgcaagttt tatgccctat
    3751  catgctagtt tggatcagaa agttggtcaa ggagatttta tgctgaagta
    3801  ccaggaatgg gcagaaccta aaatcctggg accaggatgt agagcaatgg
    3851  gtctcataga gccagagcat gccttagcag ctagcggaaa gacaacgttt
    3901  gttgaaactc cagaagaatg gcatttggat tatccatgtg ataaacttcc
    3951  aagtgtgctg actcgaggtg acccaagatt ggcaggaata atccatgcag
    4001  attatgatcc atttgcttct gggatgagca agtatgctaa agaggcaggc
    4051  ccttttgacg cagctagtct caagcaagtg tgttcaggaa ttgttgagat
    4101  ttgggaagat gcttcggcag atttccccat ggatgaggtt gatctagaca
    4151  ctgccattaa tggtttggaa aacgtggaat tttttgatgc tttggttctc
    4201  ggaacttctg aggggtttcc atatcggctt gatcgtggtc ctggtgacaa
    4251  aggaaagagc aggtatgtgt cgggagagag cggcaatttg aaaataactg
    4301  atgaaggagt tctctcagat atatcttggt ttgaggaagt gagcaaaact
    4351  caagtgccag acctttattg cattgagtgt gtgaaagatg aacgtctgcc
    4401  aattagaaaa gtgttgcatg agcccaagag taggttgttc acagtattac
    4451  caatgtccta taacatcgtc attaggaaga aatttttgaa ttttgtcaga
    4501  ttcttcatga aaaggcgaga cgtgctaccg gctcaagttg ggattaatcc
    4551  ctactcgaga gaatggaccc gaatggccaa caagttgttg agcaaaggaa
    4601  acaacatttt gtgttgtgat tatagcagat ttgatggttt cttgcccaag
    4651  tgcatcatga atgagatagg tgacatgata gccaagctca tgaaggctga
    4701  tgaagtgtca aaaacccaga ttaaaaattt aatgcttgca tgcactagca
    4751  ggtatgccat gtgcaacaga gttttataca gagtagagaa tggcattcca
    4801  tcagggtttc ctttgactgt cattgttaat tctattttga atgaaatttt
    4851  ggtcaagtat gcttattggc attgttttga agataacccg aacgtgcaga
    4901  gcaattttga tgcccatgtg tcgatggttg tgtacgggga tgataatcta
    4951  atttctgttt cagatgccat aagttcgaag ttcgatggga gttttctcgt
    5001  gagtttcatg gaaggtctgg gaatcaaagt gacggatggg attgacaaaa
    5051  cgaaggttgg aattgagttt cggaggttgg agaattgtga ttttctgaag
    5101  cgttctttca agatgagccc agatggcact tggcgcagtc ccatgtctaa
    5151  agagagtttg tggccacaat tgcattttgt taaggcgaaa aaattggaaa
    5201  tggcagaagc atacatcaac aattgcaata atattttgcg tgaattgtgg
    5251  ttgcatgacg ttagagaggc caaagagttt cgcaacaaag tcttgagaaa
    5301  tttgagatgg attggacatg agcaattgct taacatgcag caactggcag
    5351  ttttccacag tgaacagatg aatggagtga atgacttttt gacagcttgt
    5401  atcacagtgg atagcatacc gctgatggat cctttagtgc ctgggatgct
    5451  gccagttaaa acatgtgaga tagtttcccg aatttttgtg gcagcagaga
    5501  aacattttga aggaaatttc agtgatttct ttacaatctc aataactacg
    5551  agccgcaagt ttgaagaaga taagggattc gttcttttgt ttccgtatgg
    5601  agcagggagg ggaggattgc caactactca gtttatgaga gaaaatgtca
    5651  ttaggaaagg atcgtcgatt cagaaaaagt ttaggcaagc acatgagaaa
    5701  ggaaataaca ctcttttcat ctcacagagt tcggtagttc ctgcttatgt
    5751  ttttgctgtg atgcttttgc attctatagg ggcaattact agattatcca
    5801  gcaacaaagc acttactcaa gcaatgcaaa cttgcaagaa attggagtat
    5851  ttacctagag agtacgaaga gttcttttga tttgtgtgcg ttgtatgtgt
    5901  atattttatg taaatcacta cttttattgt ataatatgta ttatgcaggg
    5951  ttgaaatgcc ttttcccaag taaatttcag tagtgaggg