!!NA_SEQUENCE 1.0
ID   AF149425   standard; RNA; VRL; 5956 BP.
XX
AC   AF149425;
XX
SV   AF149425.1
XX
DT   21-JUN-1999 (Rel. 60, Created)
DT   07-SEP-2000 (Rel. 65, Last updated, Version 2)
XX
DE   Broad bean wilt virus 2 RNA1 polyprotein gene, complete cds.
XX
KW   .
XX
OS   broad bean wilt virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Fabavirus.
XX
RN   [1]
RP   1-5956
RX   MEDLINE; 20404879.
RA   Qi Y., Zhou X., Li D.;
RT   "Complete nucleotide sequence and infectious cDNA clone of the RNA1 of a
RT   Chinese isolate of broad bean wilt virus 2";
RL   Virus Genes 20(3):201-207(2000).
XX
RN   [2]
RP   1-5956
RA   Qi Y.J., Zhou X.P., Li D.B.;
RT   ;
RL   Submitted (10-MAY-1999) to the EMBL/GenBank/DDBJ databases.
RL   Biotechnology Institute, Kaixuan Road, Hangzhou, Zhejiang 310029, P.R.China
XX
DR   SPTREMBL; Q9WNW0; Q9WNW0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5956
FT                   /chromosome="RNA1"
FT                   /db_xref="taxon:76875"
FT                   /organism="broad bean wilt virus 2"
FT                   /isolate="B935"
FT   CDS             234. .5846
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9WNW0"
FT                   /product="polyprotein"
FT                   /protein_id="AAD39217.1"
FT                   /translation="MDFSTMQVVVGFLKTSMGLQSIRDIVQKAKVDEKDKTLLHIHLCF
FT                   FHANEMARDLNEGMDVSQIHSSAAIKYRAAIVTRHVKMNVETGGYDRKRMVEYNNETCV
FT                   NWFSCEFKEEKEESQELPVDEDCVEEIVENFLENCGISDQNDQISTTSNANYAFGQGLY
FT                   EYATRVSDAIVAVISGSIKKGIDEFLDKVYAAMSQIFAAWMPKIRAAFQWFENIKEVVK
FT                   NWARTMHEKINCILVGMEDCLYMGAGLVAATCIVTLLEKFMVVTKILPAPCGAATLFLT
FT                   TAMATISAAYVCTKAVEKSVMLTNVLHFVTTNCQIVLNALFNHDATKKELGANQNEGEA
FT                   PTGVGQFGISTMLQDVANLMSTWSTNSVTEIGRTFGAISQIKNGILALRDMVYFVFEKL
FT                   SDLAHKVLGFESQVLADLTILLGENVADWLSECDCMVSYMLEFNSRNREIFDRLSQLIE
FT                   KGRLIRTGVLRTGHRGSSQVMALVTKALEKLIELHNSVVMSGSNTTRKAPFMVFFTGAS
FT                   GTGKTSVVQRVAINWLQEEQLGTNEIYSRNGQDPFWSGYKRHAVVTYDDFGAVPGTTSN
FT                   EAEIINVISRNPYATVMAGLAEKGMYFDSRLVLASRNFLAANPESGVHDSEAYERRRHA
FT                   VIRVSLKPGVPYNADDPCANQTYTLLDSKTPFREIQTFETYAELWSYLYTSFKEHEVQE
FT                   ELYLKSLPILDSDKKEALEGLVGLTVIATSFAPKAVMQYGMEKFPGHHFLVSDGEKCYF
FT                   WHGDGSVESASVEQMQLSKQDVAQLKQQGLSTAMMYKDLAKAFPTLNSLAVLYAKNIVV
FT                   KRWVGPDLEPTKTCEDVYMREQIGNLPKWQRAYLYVLSKYLTTQSPRGWFMECLEETKK
FT                   NLRATYLWEYKQWPLPLKLALGSLIAIMAGGAIWYSLQSLWCMSGDASFVAGAATVFSV
FT                   SSFAGQSDIPNRDNSERSFRNRKVRARTWQGQSSCFGDSALWIAETCMATLTFSNVRTQ
FT                   VCLAPGRGFFGVNHCLAAIPAGVMVKMDSSIGVTYFVWGKEKLLQFDGNEIALYMTSTL
FT                   PKTVDSLLGRIHFDVETLPKTFSAVFFSYKYDPMIQQMVPELGSVTCKVHNKAYTLAHG
FT                   EYRREIPQSLSYEASTVAGDCGSLILAEIEGKFKLVGMHVAFNGREGSASFMPYHASLD
FT                   QKVGQGDFMLKYQEWAEPKILGPGCRAMGLIDPEHALAASGKTTFVETPEEWHLDYPCD
FT                   KLPSVLARGDPRLAGTVHADYDPFASGMSKYAKEAGPFDAASLKQVCSGIVEIWEDASA
FT                   DFPMDEVDLDTAINGLENVEFFDALVLGTSEGFPYRLDRGPGDKGKSRYVSGESGSLKI
FT                   TDEGVLSDIAWFEEVSKTQVPDLYCIECVKDERLPIRKVLHEPKSRLFTVLPMSYNIVI
FT                   RKKFLNFVRFFMKRRDVLTAQVGINPYSREWTRMANKLLSKGNNILCCDYSRFDGFLPK
FT                   CIMNEIGNMIARLMKTDEVSRTQIKNLMLACTSRYAMCNRVLYRVENGIPSGFPLTVIV
FT                   NSILNEILVKYAYWHCFEDNPSVQSNFDAHVSMVVYGDDNLISVSDAISSRFDGNFLVS
FT                   FMEGLGIKVTDGIDKTKVGIEFRRLENCDFLKRSFKMSPDGTWRSPMSKESLWPQLHFV
FT                   KAKKLEMAEAYINNCNNILRELWLHDVKEAEEFRNKVLRNLRWIGHEQLLNMQQLAVFH
FT                   SEQMNGVSDFLSTCVTVDSIPLMDPLVPGMLPVKTSEIIPRVFVAAEKHFEGNFNDFFT
FT                   ISITTSRKFEEDKGFVLLFPYGAGRGGLPTTQFMRENVIRKGCSIQKKFRQAYEKGNNI
FT                   LFISQSSVVPSYVFAVMLLHSIGAISRLSSNKALTQAMQTCKRLEYLPKEYEEFF"
XX
SQ   Sequence 5956 BP; 1683 A; 1007 C; 1566 G; 1700 T; 0 other;

AF149425  Length: 5956  December 21, 2001 14:53  Type: N  Check: 6421  ..
       1  tgttttaata aaatattaaa acaaacagct ttcgttccga aaacagcttt
      51  cagttactaa acagctttcg tttcgataaa acagctttca gatacaaaca
     101  gctttcaaat ttcctctgga aaattttgtt actgcgtgac tttggaaaga
     151  acccggaaaa agggagtgtg atttaaagcg caccatatat ttcaaagatc
     201  atattgattt cattttgtta ccttaatttt aaaatggatt tcagtacgat
     251  gcaagtggtt gttggttttt tgaagacctc gatgggttta caatccattc
     301  gggatattgt gcagaaagcc aaggtggatg agaaagacaa gacattgctt
     351  cacatccacc tgtgcttttt ccatgccaat gagatggcac gagatttgaa
     401  tgaaggcatg gatgtaagcc agatacatag ctctgcagct attaagtatc
     451  gagcggcgat tgttacgcgc catgtgaaga tgaacgtgga aactggagga
     501  tatgacagaa aacgcatggt tgaatataac aatgaaacat gtgttaactg
     551  gttctcttgt gaattcaagg aggaaaaaga ggagagtcag gaactgccag
     601  ttgatgaaga ttgtgtggag gaaattgtcg agaatttttt agagaattgt
     651  ggcatttctg atcaaaatga tcaaatatcc accacaagca atgccaatta
     701  tgcgttcggc cagggactat atgaatacgc aactcgagtc agtgatgcaa
     751  tagttgcggt gatttcaggt tcaatcaaaa aaggcataga tgagtttctg
     801  gacaaagttt atgcagctat gagtcagata tttgcagcat ggatgcctaa
     851  gatcagagct gcttttcagt ggtttgagaa tatcaaagaa gttgtgaaga
     901  attgggcaag aaccatgcac gagaagataa attgcatctt ggtgggcatg
     951  gaagattgcc tctacatggg ggctgggctt gtcgcagcca cgtgcattgt
    1001  cacactgctg gaaaaattta tggtggtaac caagattctt cccgcgcctt
    1051  gtggagcggc aaccttgttt ttaacgactg ctatggcaac tatttcagca
    1101  gcgtatgtat gcactaaggc tgtggagaag tcagtcatgc tcaccaatgt
    1151  gttacatttt gtaactacca attgtcaaat tgtgttgaac gctttgttca
    1201  accatgatgc gaccaagaaa gagttggggg caaatcaaaa tgaaggtgaa
    1251  gccccgacag gcgttggaca atttgggatc tcaacaatgc tgcaagatgt
    1301  agctaatttg atgtcaacat ggtctacgaa ttcagttaca gaaattggaa
    1351  gaacttttgg tgctatttcg cagatcaaaa atggaatttt ggccttgaga
    1401  gacatggttt atttcgtgtt tgagaaatta agcgatttag cccacaaagt
    1451  tttgggtttt gagtcccagg ttttggctga tctaacaatt cttttgggtg
    1501  aaaatgtcgc agattggtta tcagagtgtg attgcatggt atcttacatg
    1551  cttgaattca actcaaggaa tagggagata tttgataggc tttcacaact
    1601  cattgagaaa ggcaggctaa tacgcacagg agtgttgagg acgggacacc
    1651  gtggttcttc acaggtcatg gcccttgtca ccaaagcttt agagaagctg
    1701  atagagttgc ataattcagt tgtgatgtct gggtctaaca ccactagaaa
    1751  agctcctttt atggtctttt tcacaggtgc ttcaggtaca ggaaagactt
    1801  cggtcgtgca gagagtagct atcaattggt tgcaagagga gcaacttggc
    1851  acgaatgaaa tttactcgcg taatggtcaa gacccttttt ggtcaggcta
    1901  caagaggcat gcagtcgtca catacgatga ttttggggcc gtaccaggca
    1951  caacttcgaa tgaagctgag attattaatg tgatatcaag gaatccgtac
    2001  gcaacggtta tggcaggact ggcagagaaa gggatgtact tcgactcgag
    2051  gttggttctg gctagtagaa attttctggc tgccaatcct gagtcaggag
    2101  ttcacgattc tgaagcatat gagcggcgaa gacacgcagt aataagggtt
    2151  tctctcaagc caggggtgcc ttataatgca gatgatccat gtgccaatca
    2201  aacgtacact ttgcttgatt ccaagacgcc ttttagggag atccaaacat
    2251  ttgaaactta tgctgagttg tggtcttatt tgtacacgag tttcaaggaa
    2301  catgaagtgc aagaggaatt gtacttgaaa tctttgccta ttttggactc
    2351  agacaagaaa gaagctttgg agggtcttgt gggcctcacg gttatagcta
    2401  cctcatttgc tcctaaggca gtaatgcagt atggaatgga gaaattccct
    2451  ggtcaccatt ttttggtctc tgatggggag aagtgctact tttggcatgg
    2501  agatggctca gtggagagcg ccagcgtgga gcagatgcaa ttgagtaagc
    2551  aagatgtggc gcagttgaag caacaaggat tgtcaacagc gatgatgtac
    2601  aaggatttgg ctaaggcctt tccaactttg aattcgttag ctgtgctgta
    2651  tgcaaagaac atcgtggtga aacgctgggt ggggccagat ttggagccta
    2701  caaaaacttg tgaggatgta tacatgcggg agcaaatagg caatttgcca
    2751  aagtggcaaa gggcgtattt gtatgtgctc agtaagtatc tcacaaccca
    2801  gagtccacga ggatggttca tggagtgctt ggaagagaca aagaagaatt
    2851  tgagagcaac ttacttgtgg gagtacaagc agtggccatt gcctctgaaa
    2901  ttggctttgg gatctttgat agccattatg gcaggtgggg cgatttggta
    2951  ttcgctgcaa tctttgtggt gcatgtcagg agatgcctct tttgtggcgg
    3001  gagcagcaac agtattttca gtatcttcat ttgccgggca aagcgatatt
    3051  cctaatcgag ataattcaga gagatcattc agaaatagga aggtgcgtgc
    3101  aagaacatgg cagggtcaga gttcatgctt tggagactca gcgttgtgga
    3151  ttgctgaaac atgtatggcg actttgactt tttccaatgt taggacacaa
    3201  gtgtgcttgg ctcctggaag agggttcttt ggagtgaacc attgtctcgc
    3251  ggcaattccc gcgggagtta tggtgaagat ggattccagc attggtgtga
    3301  catattttgt gtggggaaaa gagaagttgc tgcaatttga tggcaatgag
    3351  atagctctgt acatgacaag cactttgccc aagacagtgg attcactttt
    3401  ggggcggatc cattttgatg tggaaacttt gcctaaaact tttagtgctg
    3451  tctttttctc ttacaagtac gacccaatga ttcaacagat ggtacctgaa
    3501  cttgggagtg ttacatgtaa agtccataat aaagcttaca cgcttgccca
    3551  tggtgagtac aggagggaaa ttccccaaag tctttcatat gaagctagta
    3601  ctgtggcagg ggattgtgga tctttgattt tggcggagat tgaagggaag
    3651  tttaaacttg tcggaatgca tgtagctttc aatggaagag aagggagtgc
    3701  aagtttcatg ccttaccatg ctagtttgga tcagaaggtc ggccaagggg
    3751  attttatgtt gaagtaccag gaatgggcgg aacccaaaat tctggggcca
    3801  gggtgcagag caatgggtct aatagatcca gagcacgctt tggcggcgag
    3851  tggcaagacg acgtttgttg agaccccaga agaatggcac ttggattatc
    3901  catgtgataa attaccgagt gttctagcgc gtggggatcc aagattggcg
    3951  gggacagtcc atgcagacta tgatccattt gcttccggga tgagtaaata
    4001  tgctaaggag gcaggccctt ttgatgctgc tagtctaaag caggtgtgtt
    4051  cgggaattgt ggagatatgg gaagacgcct cggcagactt ccccatggat
    4101  gaggtggatt tggatactgc catcaatggt ttggagaatg tggaattctt
    4151  tgatgcgttg gttcttggca cttccgaggg atttccatac cggcttgatc
    4201  gtggtcctgg tgataagggc aagagcagat atgtttcagg tgagagtggt
    4251  agtttgaaga taacagatga aggtgtcctt tcagacatag cttggtttga
    4301  agaagtgagt aaaactcaag tgccagatct ttattgcatt gagtgtgtga
    4351  aagatgagcg cttgccgatc cggaaagtgt tacacgagcc caagagcagg
    4401  ttgttcacag tgcttccaat gtcttacaac atcgttatta ggaagaaatt
    4451  cctaaacttt gtcagatttt tcatgaaaag gcgagatgtg ctaacagccc
    4501  aagttgggat taacccttac tcgcgagagt ggactcgaat ggctaacaag
    4551  ttgttgagca aagggaacaa cattttgtgt tgtgactata gcagatttga
    4601  tggctttctg cctaagtgca ttatgaacga gatagggaat atgattgcaa
    4651  gactcatgaa gactgatgaa gtgtcaagaa cccagataaa gaatttgatg
    4701  cttgcctgca ccagtaggta tgccatgtgc aacagagttt tatacagagt
    4751  tgaaaatggc atcccatctg gctttccctt gacagttatt gtgaattcca
    4801  tcttgaatga gattttggtt aagtatgcat actggcattg ttttgaggac
    4851  aatccgagtg tgcaaagcaa ctttgatgca catgtgtcaa tggttgttta
    4901  tggagacgat aatttaattt ccgtgtcaga tgccataagc tcaagatttg
    4951  atgggaattt tcttgtgagt tttatggagg gattaggaat caaagtgacg
    5001  gacgggattg acaaaacaaa ggtcggaatt gagtttcgga ggttggaaaa
    5051  ttgcgatttt ctgaagcgtt cgttcaagat gagcccggat ggcacttggc
    5101  gtagtcccat gtccaaagag agcttgtggc cacaattgca ttttgttaag
    5151  gcaaagaagt tggagatggc ggaggcatat atcaacaatt gcaataacat
    5201  tttgcgtgaa ttgtggttgc atgatgtgaa ggaggccgag gagtttcgca
    5251  acaaagtttt gaggaatttg agatggatag gacatgagca attgcttaat
    5301  atgcaacagc tggcagtctt ccatagtgag caaatgaacg gggtgagtga
    5351  tttcttgtca acttgtgtca cagtggacag cataccattg atggatcctt
    5401  tggtgcctgg gatgttgcca gttaaaacaa gtgagataat cccccgggtt
    5451  tttgtagcag cagagaagca ttttgaagga aattttaatg attttttcac
    5501  aatttcgata actacgagcc gcaaatttga ggaagataag gggtttgtcc
    5551  ttttgtttcc gtacggagct ggcaggggag gtttgccaac cactcagttc
    5601  atgagagaaa acgtgatacg gaaaggatgc tcaatacaga agaagttcag
    5651  gcaagcttat gagaaaggaa acaacattct ctttatttca caaagttcag
    5701  tagttccttc ttatgttttt gctgtgatgt tattacactc cataggagca
    5751  atttctaggt tgtcaagcaa taaggcgctc actcaagcaa tgcaaacttg
    5801  caagagatta gagtatttac ccaaagagta tgaagagttc ttttgatttt
    5851  gtttgaattg tgtgtgaata ttttatgtaa atcactactt atattgtata
    5901  atatgtatta tgcagggttg aaatgccttt tcccaagtaa atttcagtag
    5951  tgaggg