!!NA_SEQUENCE 1.0
ID   AF197544   standard; genomic RNA; VRL; 1412 BP.
XX
AC   AF197544;
XX
SV   AF197544.1
XX
DT   05-DEC-2000 (Rel. 66, Created)
DT   29-MAY-2003 (Rel. 75, Last updated, Version 2)
XX
DE   Beet necrotic yellow vein virus isolate D71 RNA 4 segment, partial
DE   sequence.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1412
RX   MEDLINE; 20456802.
RX   PUBMED; 11003469.
RA   Koenig R., Lennefors B.L.;
RT   "Molecular analyses of European A, B and P type sources of Beet necrotic
RT   yellow vein virus and detection of the rare P type in Kazakhstan";
RL   Arch. Virol. 145(8):1561-1570(2000).
XX
RN   [2]
RP   1-1412
RA   Koenig R.;
RT   ;
RL   Submitted (21-OCT-1999) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land und Forstwirtschaft, Messeweg 11, D
RL   38104 Braunschweig D 38104, Germany
XX
DR   SPTREMBL; Q9DS85; Q9DS85.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1412
FT                   /country="Germany"
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /note="almost complete sequence of RNA 4; lacks only a few
FT                   nucleotides at the 5'- and 3'-ends type: B"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="D71"
FT                   /segment="RNA 4"
FT   CDS             348. .1196
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9DS85"
FT                   /product="unknown"
FT                   /protein_id="AAG37076.1"
FT                   /translation="MADGEICRCQVTDPPLIRHEDYDCTARMVQKRIEIGPLGVLLNLN
FT                   MLFHMSRVRHTDVYPYLNNIMSVSVSLDVPVPSGVGVGRARVLIFTTSRERVGIFHGWQ
FT                   VVPGCFLNAPCYSGVDVLSDELCEANIINTSVSSVAMFNRSYKPEDVWILLLTSSTCYG
FT                   YHDVVVDIEQCTLPSNIDGCVHCSGVCYFNDNHCFCGRRDSNPSNPPCFQFIKDCNELY
FT                   GTNETKQFICDLVGDANLDSVNTLTKEGWRRFCDVLWNTTYGDVESRTFARFLWFVFYH
FT                   D"
XX
SQ   Sequence 1412 BP; 345 A; 209 C; 322 G; 536 T; 0 other;

AF197544  Length: 1412  January 7, 2004 15:42  Type: N  Check: 3008  ..
       1  agttgattgt ctgtaaaaca attccagttg tttgtctgta aaacaaacat
      51  gtatgcttga tcagctttgt aggtccttga ttatcaactt tatttctatc
     101  attgaatttg aattgtttct gttgcgattc tctttacgat ttgtgtcgtc
     151  atttcgtata ttggaagacg tgtctgattc cagtattaat tggtcagttt
     201  ataggtgcag aacgctttta agtgagacct gagactgcgt cggaacctta
     251  gattcacgag ccgcgtgatt aattgggttt gtcactggga tccagtctat
     301  cagtaagggg tagtcttttg ttgagactta tctgtttagt aacatttatg
     351  gctgatggag agatatgtcg gtgtcaggtt actgatcctc ctttgatacg
     401  tcatgaagac tatgattgta ctgctaggat ggtgcagaaa cggattgaga
     451  ttggcccatt gggtgtttta ctcaatctaa acatgttatt tcatatgtct
     501  cgtgttagac atactgatgt ttatccgtat ctgaataata ttatgtctgt
     551  ttcggtgtcg ttggatgttc ctgtgcctag tggcgttggt gttggacgtg
     601  cacgtgtttt aatatttaca actagtcgtg aacgtgttgg tatattccat
     651  ggatggcagg ttgtgcctgg gtgctttctt aatgccccgt gttatagtgg
     701  tgttgatgtt ctgtccgatg agttatgtga agctaatatt atcaatactt
     751  cggtttcgtc tgttgcgatg ttcaataggt cgtataaacc cgaagacgtc
     801  tggatactat tacttacgtc tagtacttgt tatggttatc atgatgttgt
     851  tgttgatata gaacaatgca cattaccttc taatatagat gggtgtgttc
     901  attgttctgg tgtttgctat ttcaatgata atcattgttt ttgtggtcgt
     951  cgtgatagta atccatccaa tccgccttgt tttcaattta ttaaagattg
    1001  taatgagttg tatggaacaa atgaaactaa acaattcatt tgtgacctcg
    1051  ttggtgatgc taacttggac agtgttaata ctctaacaaa ggaagggtgg
    1101  cgaaggtttt gtgatgttct ttggaatacc acttatggtg atgttgagtc
    1151  tcgtactttt gcacgctttc tgtggtttgt cttttatcac gattagtggt
    1201  atttatgatg tgtttagtta ttcgagatac aagaataata atatgtataa
    1251  ttgtactatt aacgggctcg ttcacaagcc tccttgctat ggtaaggttt
    1301  atgtgaacac aaaaatatgg cttattggtt atgctaaacc tcatatcgta
    1351  ttaaatatat ataagttaag gttgagatgt actgactggg tgtgaaatgt
    1401  accagtcttt at