!!NA_SEQUENCE 1.0
ID   AF197546   standard; genomic RNA; VRL; 1417 BP.
XX
AC   AF197546;
XX
SV   AF197546.1
XX
DT   05-DEC-2000 (Rel. 66, Created)
DT   29-MAY-2003 (Rel. 75, Last updated, Version 2)
XX
DE   Beet necrotic yellow vein virus isolate F72 RNA 4 segment, partial
DE   sequence.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1417
RX   MEDLINE; 20456802.
RX   PUBMED; 11003469.
RA   Koenig R., Lennefors B.L.;
RT   "Molecular analyses of European A, B and P type sources of Beet necrotic
RT   yellow vein virus and detection of the rare P type in Kazakhstan";
RL   Arch. Virol. 145(8):1561-1570(2000).
XX
RN   [2]
RP   1-1417
RA   Koenig R.;
RT   ;
RL   Submitted (21-OCT-1999) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land und Forstwirtschaft, Messeweg 11, D
RL   38104 Braunschweig D 38104, Germany
XX
DR   SPTREMBL; Q9DGS4; Q9DGS4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1417
FT                   /country="France"
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /note="almost complete sequence of RNA 4; lacks only a few
FT                   nucleotides at the 5'- and 3'-ends type: P"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="F72"
FT                   /segment="RNA 4"
FT   CDS             349. .1197
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9DGS4"
FT                   /product="unknown"
FT                   /protein_id="AAG37078.1"
FT                   /translation="MADGEICRCQVTDPPLIRHEDYDCTARMVQKRIEIGPLGVLLNLN
FT                   MLFHMSRVRHIDVYPYLNNIMSISVSLDVPVSSGVGVGRVRVLIFTTSRERVGIFHGWQ
FT                   IVPGCFLNAPCYSGVDVLSDELCEANIVHTSVSSVAMFDRSYKPEDVWILLLTSSTCYG
FT                   YHDVVVEIDQCTLPSNIDGCVHCSGVCYFNDNHCFCGRRDSNPFNPPCFQFIKDCNELY
FT                   GTNETKQFICGLVGDDNLDSVNTLTKEGWRRFCDVLWNTTYGDVESRTFARFLWFVFYH
FT                   D"
XX
SQ   Sequence 1417 BP; 347 A; 205 C; 326 G; 539 T; 0 other;

AF197546  Length: 1417  January 7, 2004 15:42  Type: N  Check: 3687  ..
       1  agttgattgt ctgtaaaaca attccagttg tttgtctgta aaacaaacat
      51  atatgcttga tcagctttgt agatccttga ctatcaattt tatttctatc
     101  attgaattcg aattgtttct gttgagattc tctttacgat ttgtgtcgtc
     151  atttcgtata ttggaagacg ggcctgattc cagtattaat tggtcagttt
     201  gtaggtgcag aacgctttta agtgagacct aagactgcgt cggaacctta
     251  gattcacgag ccgcgtgatt aattgggttt gtcactggga tccagtctat
     301  cagtaagggg taggtttttt gttgagactt atctgattag taacatttat
     351  ggctgatgga gagatatgtc ggtgtcaggt tactgatcct cctttgatac
     401  gtcatgaaga ctatgattgt actgctagga tggtgcagaa acggattgag
     451  attggcccat tgggtgtttt actcaatctt aatatgttat ttcatatgtc
     501  tcgtgttaga catattgatg tttatccgta tctgaataat attatgtcta
     551  tttcggtgtc gctggatgtt cctgtgtcta gtggcgttgg tgttggacgt
     601  gtacgtgttt taatatttac aactagtcgt gaacgtgttg gtatattcca
     651  cggatggcag attgtgcctg ggtgctttct taatgccccg tgttatagtg
     701  gtgttgatgt tctgtctgat gagttatgtg aagctaacat tgttcatact
     751  tcggtttcgt ctgttgcgat gttcgatagg tcgtataaac ctgaagacgt
     801  ctggatacta ttacttacgt ctagtacttg ttatggttat catgatgttg
     851  ttgttgagat agaccaatgt acattacctt ctaatataga tgggtgtgtt
     901  cattgttctg gcgtttgcta tttcaatgat aatcattgtt tttgtggtcg
     951  tcgtgatagt aatccattca atccgccttg ttttcaattt attaaagatt
    1001  gtaatgagtt gtatggtaca aatgaaacta aacaattcat ttgtggcctt
    1051  gttggtgatg acaatttgga cagtgttaac actctaacaa aagaagggtg
    1101  gcgaaggttt tgtgatgttc tttggaatac cacttatggt gatgttgagt
    1151  ctcgtacttt tgcacgcttt ctgtggtttg tcttttatca cgattagtgg
    1201  tatttacgat gtgtttagtt attcgagata caagaataat aatatgtata
    1251  attgtattat taacgggctc gttcacaagc ctccttgcta tggtaaggtt
    1301  tatgtgaaca caaaaatatg gcttattggt tatgctaaac ctcatatcgt
    1351  attaaatata tataagttaa ggttgagatg tactgactgg gtgtgaaatg
    1401  taccagtctt tataggg