!!NA_SEQUENCE 1.0
ID   AF197547   standard; genomic RNA; VRL; 4544 BP.
XX
AC   AF197547;
XX
SV   AF197547.1
XX
DT   05-DEC-2000 (Rel. 66, Created)
DT   29-MAY-2003 (Rel. 75, Last updated, Version 2)
XX
DE   Beet necrotic yellow vein virus isolate F75 RNA 2 segment, partial
DE   sequence.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-4544
RX   MEDLINE; 20456802.
RX   PUBMED; 11003469.
RA   Koenig R., Lennefors B.L.;
RT   "Molecular analyses of European A, B and P type sources of Beet necrotic
RT   yellow vein virus and detection of the rare P type in Kazakhstan";
RL   Arch. Virol. 145(8):1561-1570(2000).
XX
RN   [2]
RP   1-4544
RA   Koenig R.;
RT   ;
RL   Submitted (21-OCT-1999) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land und Forstwirtschaft, Messeweg 11, D
RL   38104 Braunschweig D 38104, Germany
XX
DR   GOA; Q9DS80.
DR   GOA; Q9DS82.
DR   GOA; Q9DS83.
DR   SPTREMBL; Q9DS79; Q9DS79.
DR   SPTREMBL; Q9DS80; Q9DS80.
DR   SPTREMBL; Q9DS81; Q9DS81.
DR   SPTREMBL; Q9DS82; Q9DS82.
DR   SPTREMBL; Q9DS83; Q9DS83.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4544
FT                   /country="France"
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /note="almost complete sequence of RNA 2; lacks only a few
FT                   nucleotides at the 5'- and 3'-ends type: P"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="F75"
FT                   /segment="RNA 2"
FT   CDS             join(107. .670,674. .2179)
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9DS83"
FT                   /db_xref="SPTREMBL:Q9DS83"
FT                   /note="contains read-through stop codon"
FT                   /product="coat protein"
FT                   /protein_id="AAG37079.1"
FT                   /translation="MSSEGRYMTWKDMSHNRFMTDRWARVSDVVSVIKQSHAMDSSKAA
FT                   NLSIIKTALAGLGSGWTDNNPFVSPMTRFPQTLTMYGALVLYVNLSDPEFALIMTKIST
FT                   LTDSGLADNASANVRRDVVSGNKAESSGKTAGTNENSAYTLTVSLAGLAQALRLEELMW
FT                   TRDKFEDRLKLPWTPVQGRTSPPGQQLAAARVTAHIRAAKRALLYPGDSPEWVGWKHFY
FT                   PPPPYDVYDVPPLDIINAKLAADDIGGLVTPTPASSHGLPFEVSEEVEQANRNSLWLTV
FT                   GLLLAALAVGIGVAAYHRKKLQSRLRELKLLWGSTGGSGGGGGLDTELYMRATDTVSLG
FT                   TTPSEHAALAPSGLRHRPAATDSGPHEALPFEVWVFDNLAVVYDSIGMSDLFYTVREFV
FT                   GVFNGEFEGLIELFESPDDDDGVYTNAPRDTAIDAYESQENYDRIDIETVLLERRINLK
FT                   KLLLEEAELERRERDMTMIADEEQRTLLHRLESSRVEAAHAVAKAEADARAAVAMAALA
FT                   SKEANDYDSKMAFDRSCKEQELRLRELEVNSMPSKTERYVHTGIQGGAQLAGAMAVGAM
FT                   LRRGASSSSQTVSSGANIGSRSQSLTRGRSASQPLSSVGGSTRGVNNNISNTNLVRAGN
FT                   SAEVSAGRSTNSGNSNFWSKLRVGEGWSKYSVERAATRAQRAITLPAPPSAPAG"
FT   misc_feature    671. .673
FT                   /note="read-through stop codon"
FT   CDS             2092. .3246
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9DS82"
FT                   /db_xref="SPTREMBL:Q9DS82"
FT                   /note="first triple gene block; necessary for virus
FT                   movement"
FT                   /product="unknown"
FT                   /protein_id="AAG37080.1"
FT                   /translation="MVQVQRRTGGDKGAKGNYASSAPVRSRRMTQDDWSRTHPDDIFSV
FT                   IEKTLVEDGYKWNGVKPGHCDWGKLKESGAIDNFRGTLEGELGKNCDLPCNAAAVKLDT
FT                   LQKVKMSSDWTARVGIVLGAPGVGKSTSIKNLLDKFGAKHKMVLCLPFSQLLEGVFAGR
FT                   LDTFLVDDLFCRSVEYGKYNTMLVDEVTRVHMCEILVLAGHLGVKNVICFGDPAQGLNY
FT                   KAGSAVNYNFPIIAECYASRRFGKATADLINSSNGGGKPVVGNNEVKDSWTFEELCGKI
FT                   LDMSTVLVATRETQKFLLEDNIESILYSDAHGQTYDVVTIILEDEFDDAAICDPNVRAV
FT                   LLTRARKGGMIKMGPNIAARFKNGDFNSRGVSKSCTGDTFCEDR"
FT   CDS             3246. .3602
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9DS81"
FT                   /note="second triple gene block; necessary for virus
FT                   movement"
FT                   /product="unknown"
FT                   /protein_id="AAG37081.1"
FT                   /translation="MSREITARPNKNVPIVVGVCVVAFFVLLAFMQQKHKTHSGGDYGV
FT                   PTFSNGGKYRDRTRSADFNSNNHRAYGCGGSGGSVSSRVGQQLVVLAIVSVLIVSLLQR
FT                   LRSPPEHICNGACG"
FT   CDS             3586. .3984
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9DS80"
FT                   /db_xref="SPTREMBL:Q9DS80"
FT                   /note="third triple gene block; necessary for virus
FT                   movement"
FT                   /product="unknown"
FT                   /protein_id="AAG37082.1"
FT                   /translation="MVLVVKVDLSNIVLYIVAGCVVVSMLYSPFFSNDVKASSYAGAVF
FT                   RGSGCIMDRNSFAQFGSCDIPKHVAESITKVATKEHDADVMVKRGEVTVRVVTPTETIF
FT                   IILSRLFGLAVFLFMICLMSIVWFWCHR"
FT   CDS             4002. .4385
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9DS79"
FT                   /product="P14 protein"
FT                   /protein_id="AAG37083.1"
FT                   /translation="MGMVDSLCVFVGRVITEGSESVEGVERFSIKFSEWKLFTTAVYVE
FT                   YRQLGEKECSLKDVGRLHFNMSCVKCCRKLKCKKQNKNHSKHVQNGYLRKVRNFSILGV
FT                   CGDCCESFTLADEKHHVIVDPEV"
XX
SQ   Sequence 4544 BP; 1174 A; 766 C; 1205 G; 1399 T; 0 other;

AF197547  Length: 4544  January 7, 2004 15:41  Type: N  Check: 2670  ..
       1  gtctgttggt tcttattttg ttctgggggc aattttattc agggccctac
      51  tttaaatata ggtgcgagta ataagtagcc gccgtccaga agaagatagt
     101  actaacatgt cgagtgaagg tagatatatg acatggaagg atatgtcaca
     151  taataggttt atgaccgatc gatgggcccg tgtttcggac gtcgtgagtg
     201  ttattaaaca atcgcatgct atggactcgt ccaaggctgc gaatctatct
     251  ataattaaaa ctgctttggc aggattaggc tcgggttgga ctgacaataa
     301  tccttttgtg tccccgatga cccgttttcc acagacacta actatgtacg
     351  gtgcacttgt gttatatgtt aatctgtctg acccagaatt tgcgttgata
     401  atgactaaga taagtacttt aactgattca gggttagcag ataacgcatc
     451  tgctaatgtg cgtagagatg tggtgtccgg aaataaagcc gaatcatccg
     501  gtaaaactgc tggcactaat gagaattctg cttatacgct taccgttagt
     551  cttgctggtt tggctcaagc tcttaggctt gaggaattaa tgtggactcg
     601  ggataagttt gaggaccggt tgaaattacc atggacacct gttcaaggta
     651  gaaccagtcc acccggacaa tagcaattag ctgctgctcg ggtgacggca
     701  cacattcgag cggcgaagcg ggcactatta tatcctggtg atagtcccga
     751  gtgggttggt tggaaacatt tctatcctcc tccaccatat gatgtgtacg
     801  atgtgccacc gctggatatt attaacgcca aattggctgc tgatgatatc
     851  ggcggtcttg ttactcctac accggcatcc tcacatggtc ttccttttga
     901  agtttccgag gaagttgagc aggcaaatag gaatagtcta tggctaacag
     951  ttggactgct attagctgct ttggcagttg gaattggtgt agctgcttat
    1001  cataggaaga agctccaaag tagattacgt gagttaaaat tgctatgggg
    1051  ttctactggt gggtctggtg gtggtggtgg tttggacacc gagctgtata
    1101  tgcgcgctac agatactgtt agtttgggaa ccactccttc agagcatgct
    1151  gctttagctc cgtcggggtt acggcaccga cctgctgcta ctgatagtgg
    1201  acctcatgaa gcactgccgt ttgaggtgtg ggtgtttgat aatctagctg
    1251  tagtgtatga ttcgattggt atgagtgatt tattctatac tgttagagag
    1301  tttgttgggg tgttcaacgg tgagtttgaa gggcttatag agctgtttga
    1351  gtcacccgat gatgatgatg gtgtgtatac caatgctcct agagacactg
    1401  ccattgatgc ctatgaatcc caagaaaact acgatcgtat tgatattgaa
    1451  actgtcttgc tcgagaggcg tataaacttg aaaaagctgc ttcttgaaga
    1501  agcagagcta gaacgacgag agcgagatat gaccatgatt gctgatgaag
    1551  aacaaagaac attattacat aggttggaaa gttctagggt tgaagcagct
    1601  catgcagttg ccaaagccga agctgatgct cgggcagctg ttgctatggc
    1651  tgctcttgct tccaaggaag ctaatgatta cgacagtaag atggcttttg
    1701  acaggtcttg taaagaacag gaactgcggt tgcgcgaact cgaagtgaat
    1751  agtatgccga gtaaaacaga gaggtatgtt catactggta tacaaggtgg
    1801  cgcgcaattg gctggagcta tggctgttgg tgctatgctg cgacgtgggg
    1851  ccagttcttc ttctcaaacc gtttctagtg gtgctaatat tggttcccgc
    1901  tcacagagtt tgactcgtgg tcgtagtgca tcacaacctt tgtcatcagt
    1951  tggtggttct actcgtgggg ttaataataa tattagtaat actaatcttg
    2001  ttagggctgg taatagtgct gaagtttctg ctggtagatc tactaatagt
    2051  ggtaatagta acttttggtc caaattgcgt gttggtgaag gatggtccaa
    2101  gtacagcgta gaacgggcgg cgacaagggc gcaaagggca attacgcttc
    2151  cagcgccccc gtccgctccc gccggatgac tcaggatgac tggtcacgta
    2201  cccatcccga cgatattttc tcagttattg agaaaacact agtagaggat
    2251  gggtataaat ggaacggggt aaaacccgga cattgcgatt ggggcaaatt
    2301  gaaggaatct ggtgctattg ataattttag gggtacatta gaaggcgagt
    2351  taggtaaaaa ttgtgattta ccttgtaatg ctgctgccgt taaacttgac
    2401  acattgcaaa aggtgaaaat gtcatcagat tggactgcca gagttggtat
    2451  tgttttgggt gctcctggtg ttgggaaatc tacctcgatt aagaacttac
    2501  tagacaaatt tggagcaaaa cataaaatgg tgttatgctt accttttagt
    2551  cagttgttag aaggagtgtt tgctggtcgg ttggacactt ttctggttga
    2601  tgatttgttc tgtaggtccg tggaatatgg aaaatacaac accatgcttg
    2651  tagatgaggt cactcgtgtg catatgtgtg agattttggt acttgccgga
    2701  catttaggtg ttaagaacgt gatatgtttt ggtgatccgg cgcaagggtt
    2751  aaattataag gccggttctg ccgtgaacta taattttccg attattgctg
    2801  aatgttatgc tagtagacgg ttcggtaagg cgactgccga tctcattaat
    2851  tccagcaatg gtggtggtaa acctgtagtc ggtaataacg aggtaaagga
    2901  tagttggact tttgaagaac tatgtgggaa gatactagat atgtctactg
    2951  ttttggtagc aacacgcgaa acccaaaagt ttctattaga agataatatt
    3001  gagtctattc tttactcgga cgcccacggg caaacatacg acgttgtcac
    3051  tatcattttg gaagatgagt ttgatgatgc tgccatttgc gacccaaatg
    3101  ttagggctgt cttgttaact agagctcgta agggtggtat gattaagatg
    3151  ggtcctaaca ttgctgccag gttcaaaaac ggtgatttta attcacgtgg
    3201  agttagtaag tcttgcaccg gagatacctt ttgcgaagat agataatgtc
    3251  tagggaaata accgctcgac ccaataagaa tgtgcctatt gttgttggtg
    3301  tctgtgttgt ggctttcttt gtattgctgg cgttcatgca gcaaaaacat
    3351  aagacacatt ctgggggcga ttacggagtc ccaacatttt ctaacggtgg
    3401  taaatataga gaccgcacaa ggtcagctga ttttaatagt aataatcatc
    3451  gtgcttacgg gtgcggtggg tctgggggta gcgttagtag tcgagtcggg
    3501  cagcaacttg ttgtgttagc tattgtgtct gtgttgatag tatcactgtt
    3551  acaacgatta agatctccac cagaacatat ttgtaatggt gcttgtggtt
    3601  aaagtagatt tatctaatat tgtgttgtat atagttgccg gttgtgttgt
    3651  tgttagcatg ttgtactcac catttttcag caacgatgtt aaagcgtcca
    3701  gctatgcggg agcagttttt agagggagtg gctgtatcat ggacaggaat
    3751  tcgtttgctc aatttgggag ttgcgatatt ccgaagcatg tagccgagtc
    3801  catcactaag gttgctacca aagagcacga tgctgatgta atggtaaaaa
    3851  gaggtgaagt gaccgttcgt gttgtgactc ccaccgaaac tattttcata
    3901  atattatcta gattgtttgg tttggcggtg tttttgttca tgatatgtct
    3951  aatgtctata gtttggtttt ggtgtcatag ataaattgtg gtagaatgag
    4001  tatggggatg gtagatagtt tgtgcgtgtt tgttggtcga gtcataactg
    4051  agggatctga aagtgttgag ggtgtggaac ggttttccat taagtttagt
    4101  gagtggaaat tgttcaccac cgcggtgtac gttgaatatc gtcagttagg
    4151  tgagaaagag tgtagtttga aggatgttgg taggttacat tttaatatgt
    4201  catgtgtgaa atgctgtcga aaacttaaat gcaagaaaca aaataaaaat
    4251  catagtaaac acgtccaaaa tggatattta cgcaaggtgc gtaatttttc
    4301  cattttaggt gtttgcggtg attgttgtga gtcttttaca cttgcggacg
    4351  aaaaacatca tgttattgtc gatcctgagg tgtaacagga tttattcaag
    4401  agactatgtt taatattaat aatcagggcc atgccacagg cctcctattg
    4451  ggttgttccg aaggttgttg tggtttatat tgcttattgg taagtgattt
    4501  gattaaggtt gcagtgtact gactgggtgt gaattgtacc agtc