!!NA_SEQUENCE 1.0
ID   AF197549   standard; genomic RNA; VRL; 1731 BP.
XX
AC   AF197549;
XX
SV   AF197549.1
XX
DT   05-DEC-2000 (Rel. 66, Created)
DT   29-MAY-2003 (Rel. 75, Last updated, Version 2)
XX
DE   Beet necrotic yellow vein virus isolate F76 RNA 3 segment, partial
DE   sequence.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1731
RX   MEDLINE; 20456802.
RX   PUBMED; 11003469.
RA   Koenig R., Lennefors B.L.;
RT   "Molecular analyses of European A, B and P type sources of Beet necrotic
RT   yellow vein virus and detection of the rare P type in Kazakhstan";
RL   Arch. Virol. 145(8):1561-1570(2000).
XX
RN   [2]
RP   1-1731
RA   Koenig R.;
RT   ;
RL   Submitted (21-OCT-1999) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land und Forstwirtschaft, Messeweg 11, D
RL   38104 Braunschweig D 38104, Germany
XX
DR   SPTREMBL; Q9DS78; Q9DS78.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1731
FT                   /country="France"
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /note="almost complete sequence of RNA 3; lacks only a few
FT                   nucleotides at the 5'- and 3'-ends type: P"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="F76"
FT                   /segment="RNA 3"
FT   CDS             421. .1080
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9DS78"
FT                   /product="P25 protein"
FT                   /protein_id="AAG37085.1"
FT                   /translation="MGDILGAVYDLGHRPYLARRTVYEDRLILSTHGNICRAINLLTHD
FT                   NRTTLVYHNNTKRIRFRGLLCALHGPYCGFRALCRVMLCSLPRLCDIPINGSRDFVADP
FT                   TRLDSSVNELLVSNGLVIHYDRVHHVPLHTDGFEVVDFTTVFRGPGNFLLPNATNFPRP
FT                   TTTDQVYMVCLVNTVNCVLRFESELTVWVHSGLYTGDVLDVDNNVIQAPDGVDDDG"
XX
SQ   Sequence 1731 BP; 428 A; 306 C; 374 G; 623 T; 0 other;

AF197549  Length: 1731  January 7, 2004 15:41  Type: N  Check: 5731  ..
       1  tggtatttat ttaccctcag ttggtgatat atgtgaggac gctagcctgt
      51  tgggtttcct gaccgaccaa atccaagcga gcttaatcca agtacctcgt
     101  ctcaaattga gtgtcaagtg aataagcata gtgaccccat cgtttcaggg
     151  tagttgacgg ctattaatag acatattaca aacgcttctc tttatttatc
     201  accaacatgg gatgtaatgt ttatgcgtga gcctacggcc gcattgtaaa
     251  attagtggtt ttgaatttct attcttcgga atatacaagg tttaaaagac
     301  cagcatttgg gttaaaaatt tttaaacctt actatcttta actagtaact
     351  cgaactcgat ttatattcag attttaaata tcaagttgtt gtgttttctg
     401  atcatcatta agggcgcgcc atgggtgata tattaggcgc agtttatgat
     451  ttagggcaca gaccttacct agcacggcgt acggtttatg aggatcgttt
     501  gattcttagc acacatggta atatctgtcg ggctattaac ttgttaactc
     551  acgataatcg tactacactg gtgtatcaca ataatactaa acgcataagg
     601  tttcgtggat tattgtgtgc tcttcatggg ccttattgtg ggtttcgtgc
     651  cttatgtaga gtaatgttat gttctctacc tcgtttgtgt gacatcccta
     701  tcaatggatc tcgcgacttt gttgcagatc ctaccagact cgacagctct
     751  gttaatgagt tgctggtttc taatggtctc gtcatccact atgatcgtgt
     801  tcatcatgtt cccttacaca ctgatggttt tgaagttgta gatttcacga
     851  ctgtctttcg tggtcctgga aactttcttt tgcctaatgc aacaaatttc
     901  cctcggccaa ccacaaccga tcaggtttac atggtgtgtt tggtaaacac
     951  ggttaattgt gtgttacgtt ttgagtccga acttacagtg tgggttcact
    1001  ctggtttgta tacaggtgat gttttagatg tggataataa tgttattcaa
    1051  gcccctgacg gtgttgatga tgatggttag agttatcaca atttcaacaa
    1101  cacgcttatt ggtgtgttgt tctgttacac catttgaaag tttaataatt
    1151  gtctcaattc gattgttgat ctggttggga caattatttt attttctttt
    1201  ggtgtaatcg cccgaagacg ttaaactaca cgtgatttca cggtgtttcg
    1251  atgagaagat tgtttaacgg tgttacgttg tgtaccttta agctttcttc
    1301  tcattttacc acatgtgatg attgtagcct gtgggttgtt atgtggacaa
    1351  ttatggttac ttatttgtaa atgataaaga gtgtgcggta gccgacttta
    1401  tgcgagtggg agtagttgtg ttattactac tattctggtt cgtataaaga
    1451  tccttgacgg cggcatcgtg ggttccacag ccggttacat ggtgttcccg
    1501  tccgtttacg aaggtttaac tgtgagcctt gtattttacg aatacacagt
    1551  ttttatctta acaggctcgt tcacaagcct ccctttacat taagtttaaa
    1601  ggtttatgtg gacacaaaaa tatggcttat tggttatgct aaacctcata
    1651  tcatgttata atattcgttt catgttataa ttaaggttaa gatgtactga
    1701  ctgggtgtga aatgtatcag tccttgtagg g