!!NA_SEQUENCE 1.0
ID   AF197553   standard; genomic RNA; VRL; 1726 BP.
XX
AC   AF197553;
XX
SV   AF197553.1
XX
DT   05-DEC-2000 (Rel. 66, Created)
DT   29-MAY-2003 (Rel. 75, Last updated, Version 2)
XX
DE   Beet necrotic yellow vein virus isolate Kas2 RNA 3 segment, partial
DE   sequence.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1726
RX   MEDLINE; 20456802.
RX   PUBMED; 11003469.
RA   Koenig R., Lennefors B.L.;
RT   "Molecular analyses of European A, B and P type sources of Beet necrotic
RT   yellow vein virus and detection of the rare P type in Kazakhstan";
RL   Arch. Virol. 145(8):1561-1570(2000).
XX
RN   [2]
RP   1-1726
RA   Koenig R.;
RT   ;
RL   Submitted (21-OCT-1999) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land und Forstwirtschaft, Messeweg 11, D
RL   38104 Braunschweig D 38104, Germany
XX
DR   SPTREMBL; Q9DS74; Q9DS74.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1726
FT                   /country="Kazakhstan"
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /note="almost complete sequence of RNA 3; lacks only a few
FT                   nucleotides at the 5'- and 3'-ends"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="Kas2"
FT                   /segment="RNA 3"
FT   CDS             422. .1081
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9DS74"
FT                   /product="P25 protein"
FT                   /protein_id="AAG37089.1"
FT                   /translation="MGDILGAVYDLGHRPYLARRTVYEDRLILSTHGNICRAINLLTHD
FT                   NRTTLVYHNNTKRIRFRGLLCALHGPYCGFRALCRVMLCSLPRLCDIPINGSRDFVADP
FT                   TRLDSSVNELLVSNGLVIHYDRVHHVPLHTDGFEVVDFTAVFRGPGNFLLPNATNFPRP
FT                   TTTDQVYMVCLVNTVNCVLRFESGLTVWVHSGLYTGDVLDVDNNVIQAPGGVDDDG"
XX
SQ   Sequence 1726 BP; 427 A; 304 C; 370 G; 625 T; 0 other;

AF197553  Length: 1726  January 7, 2004 15:41  Type: N  Check: 8088  ..
       1  ttggtattta tttaccctca gttggtgata tatgtgagga cgctagcctg
      51  ttgggtttcc tgaccgacca aatccaagcg agcttaatcc aagtacctcg
     101  tctcaaattg agtgtcaagt gaataagcat agtgacccca tcgtttcagg
     151  gtagttgacg gctattaata gacatattac aaacgcttct ctttatttat
     201  caccaacatg ggatgtaatg tttatgcgtg agcctacggc cgcattgtaa
     251  aattagtggt tttgaatttc tattcttcgg aatatacaag gtttaaaaga
     301  ccagcatttg ggttaaaaat ttttaaacct tactatcttt aactagtaac
     351  tcgaactcga tttatattca gattttaaat atcaagttgt tgtgttttct
     401  gatcatcatt aagtgaccgt catgggtgat atattaggcg cagtttatga
     451  tttagggcac agaccttacc tagcacggcg tacggtttat gaggatcgtt
     501  tgattcttag cacacatggt aatatctgtc gggctattaa cttgttaact
     551  cacgataatc gtactacact ggtgtatcac aataatacta aacgcataag
     601  gtttcgtgga ttattgtgtg ctcttcatgg gccttattgt gggtttcgtg
     651  ccttatgtag agtaatgtta tgttctctac ctcgtttgtg tgacatccct
     701  atcaatggat ctcgcgactt tgttgcagat cctaccagac tcgacagctc
     751  tgttaatgag ttgctggttt ctaatggtct cgtcatccac tatgatcgtg
     801  ttcatcatgt tcccttacac actgatggtt ttgaagttgt agatttcacg
     851  gctgtctttc gtggtcctgg aaactttctt ttgcctaatg caacaaattt
     901  ccctcggcca accacaaccg atcaggttta catggtgtgt ttggtaaaca
     951  cggttaattg tgtgttacgt tttgagtccg gacttacagt gtgggttcac
    1001  tctggtttgt atacaggtga tgttttagat gtggataata atgttattca
    1051  agcccctggc ggtgttgatg atgatggtta gagttatcac aatttcaaca
    1101  acacacttat tggtgtgttg ttctgttaca ccatttgaaa gtttaataat
    1151  tgtctcaatt cgattgttga tctggttggg acaattattt tattttcttt
    1201  tggtgtaatc gtccgaagac gttaaactac acgtgatttc acggtgttcg
    1251  atgagaagat tgtttaacgg tgttacgttg tgtaccttta agctttcttc
    1301  tcattttacc acatgtgatg attgtagcct gtgggttgtt atgtggacaa
    1351  ttatggttac ttatttgtaa atgataaaga gtgtgcggta gccgacttta
    1401  tgcgagtggg agtagttgtg ttgttactac tattctggtt cgtataaaga
    1451  tccttgacgg cggcatcgtg ggttccacag ccggttacat ggtgttcccg
    1501  tccgtttacg aaggtttaac tgtgagcctt gtattttaca aatacacagt
    1551  ttttatctta acaggctcgt tcacaagcct ccttttacat taagtttaaa
    1601  ggtttatgtg gacacaaaaa tatggcttat tggttatgct aaacctcata
    1651  tcatgttata atattcgttt catattataa ttaaggttaa gatgtactga
    1701  ctgggtgtga aatgtaccag tccttg