!!NA_SEQUENCE 1.0
ID   AF197554   standard; genomic RNA; VRL; 1412 BP.
XX
AC   AF197554;
XX
SV   AF197554.1
XX
DT   05-DEC-2000 (Rel. 66, Created)
DT   29-MAY-2003 (Rel. 75, Last updated, Version 2)
XX
DE   Beet necrotic yellow vein virus isolate Kas2 RNA 4 segment, partial
DE   sequence.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1412
RX   MEDLINE; 20456802.
RX   PUBMED; 11003469.
RA   Koenig R., Lennefors B.L.;
RT   "Molecular analyses of European A, B and P type sources of Beet necrotic
RT   yellow vein virus and detection of the rare P type in Kazakhstan";
RL   Arch. Virol. 145(8):1561-1570(2000).
XX
RN   [2]
RP   1-1412
RA   Koenig R.;
RT   ;
RL   Submitted (21-OCT-1999) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land und Forstwirtschaft, Messeweg 11, D
RL   38104 Braunschweig D 38104, Germany
XX
DR   SPTREMBL; Q9DGS5; Q9DGS5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1412
FT                   /country="Kazakhstan"
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /note="closely related to P type almost complete sequence
FT                   of RNA 4; lacks only a few nucleotides at the 5'- and
FT                   3'-ends"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="Kas2"
FT                   /segment="RNA 4"
FT   CDS             348. .1196
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9DGS5"
FT                   /product="unknown"
FT                   /protein_id="AAG37090.1"
FT                   /translation="MADGEICRCQVTDPPLIRHEDYDCTARMVQKRIEIGPLGVLLNLN
FT                   MLFHMSRVRHIDVYPYLNNIMSISVSLDVPVSSGVGVGRVRVLIFTTSRERVGIFHGWQ
FT                   IVPGCFLNAPCYSGVDVLSDELCEANIVHTSVSSVAMFDRSYKPEDVWILLLTSSTCYG
FT                   YHDVVVEIDQCTLPSNIDGCVHCSGVCYFNDNHCFCGRRDSNPFNPPCFQFIKDCNELY
FT                   GTNETKQFICDLVGDDNLDSVNTLTKEGWRRFCDVLWNTTYGDVESRTFARFLWFVFYH
FT                   D"
XX
SQ   Sequence 1412 BP; 348 A; 204 C; 321 G; 539 T; 0 other;

AF197554  Length: 1412  January 7, 2004 15:42  Type: N  Check: 2025  ..
       1  agttgattgt ctgtaaaaca attccagttg tttgtctgta aaacaaacat
      51  ctatgcttga tcagctttgt agatccttga ttatcaattt aatttctatc
     101  attgaattcg aattgtttct gttgagattc tctttacgat ttgtgtcgtc
     151  atttcgtata ttggaagacg ggcctgattc cagtattaat tggtcagttt
     201  gtaggtgcag aacgctttta agtgagacct aagactgcgt cggaacctta
     251  gattcacgag ccgcgtgatt aattgggttt gtcactggga tccagtctat
     301  cagtaagggg tagttttttg ttgagactta tctgattagt aacatttatg
     351  gctgatggag agatatgtcg gtgtcaggtt actgatcctc ctttgatacg
     401  tcatgaagac tatgattgta ctgctaggat ggtgcagaaa cggattgaga
     451  ttggcccatt gggtgtttta ctcaatctta atatgttatt tcatatgtct
     501  cgtgttagac atattgatgt ttatccgtat ctgaataata ttatgtctat
     551  ttcggtgtcg ctggatgttc ctgtgtctag tggcgttggt gttggacgtg
     601  tacgtgtttt aatatttaca actagtcgtg aacgtgttgg tatattccac
     651  ggatggcaga ttgtgcctgg gtgctttctt aatgccccgt gttatagtgg
     701  tgttgatgtt ctgtctgatg agttatgtga agctaatatt gttcatactt
     751  cggtttcgtc tgttgcgatg ttcgataggt cgtataaacc tgaagacgtc
     801  tggatactat tacttacgtc tagtacttgt tatggttatc atgatgttgt
     851  tgttgagata gaccaatgta cattaccttc taatatagat gggtgtgttc
     901  attgttctgg cgtttgctat ttcaatgata atcattgttt ttgtggtcgt
     951  cgtgatagta atccattcaa tccgccttgt tttcaattta ttaaagattg
    1001  taatgagttg tatggaacaa atgaaactaa acaattcatt tgtgaccttg
    1051  ttggtgatga caatttggac agtgttaaca ctctaacaaa agaagggtgg
    1101  cgaaggtttt gtgatgttct ttggaatacc acttatggtg atgttgagtc
    1151  tcgtactttt gcacgctttc tgtggtttgt cttttatcac gattagtggt
    1201  atttacgatg tgtttagtta ttcgagatac aagaataata atatgtataa
    1251  ttgtattatt aacgggctcg ttcacaagcc tccttgctat ggtaaggttt
    1301  atgtgaacac aaaaatatgg cttattggtt atgctaaacc tcatatcgta
    1351  ttaaatatat ataagttaag gttgagatgt actgactggg tgtgaaatgt
    1401  accagtcttt at