!!NA_SEQUENCE 1.0
ID   AF197555   standard; genomic RNA; VRL; 1303 BP.
XX
AC   AF197555;
XX
SV   AF197555.1
XX
DT   05-DEC-2000 (Rel. 66, Created)
DT   29-MAY-2003 (Rel. 75, Last updated, Version 2)
XX
DE   Beet necrotic yellow vein virus isolate Kas2 RNA 5 segment, partial
DE   sequence.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1303
RX   MEDLINE; 20456802.
RX   PUBMED; 11003469.
RA   Koenig R., Lennefors B.L.;
RT   "Molecular analyses of European A, B and P type sources of Beet necrotic
RT   yellow vein virus and detection of the rare P type in Kazakhstan";
RL   Arch. Virol. 145(8):1561-1570(2000).
XX
RN   [2]
RP   1-1303
RA   Koenig R.;
RT   ;
RL   Submitted (21-OCT-1999) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land und Forstwirtschaft, Messeweg 11, D
RL   38104 Braunschweig D 38104, Germany
XX
DR   SPTREMBL; Q9DS73; Q9DS73.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1303
FT                   /country="Kazakhstan"
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /note="closely related to P type almost complete sequence
FT                   of RNA 5; lacks only a few nucleotides at the 5'- and
FT                   3'-ends"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="Kas2"
FT                   /segment="RNA 5"
FT   CDS             413. .1111
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9DS73"
FT                   /product="P26 protein"
FT                   /protein_id="AAG37091.1"
FT                   /translation="MDIDHCMPVFDMAYSDDNHLPYYIQRSTHNVVRDVDYTGFICYPL
FT                   QVDLNDNVEVGADIYHMKIKTMRLNVDIYNNDDVATNFPGWVRFIVFCTPPVSSWVNGW
FT                   CSSLFSPFVGVNSLIDPKLLKRDGHGITVLHDGIYCLRYQEFFTGSFELNFRGPGNYTL
FT                   TNNVCWSPATSVDSIYVACVASWCGDSAFMLQSDSVAWVHKRFWQRPVLEFGQCLDDLP
FT                   DHDNNNNDCG"
XX
SQ   Sequence 1303 BP; 338 A; 207 C; 295 G; 461 T; 2 other;

AF197555  Length: 1303  January 7, 2004 15:42  Type: N  Check: 7468  ..
       1  cttattagta ccgctgttct aagtgacgta agtggagtgt aggcccgggg
      51  agctggatgc agtaatttat cgatgtacct tttcgactnc ctcaatttga
     101  aaacgagtgt aaagtaaaag ggaggttact aaacaaaata gccctccata
     151  cggtacgatt tataatcata tttatatgtc cacttggtgt cactcagaag
     201  cagtgtttgt gaaaatttgt gcgtgagcct tgtgccgcac ttgcgtgagc
     251  ctttggccgc ttttcctttg cgactgtact ttgtttttcc gctcgcacaa
     301  gcgttattgt actagttacg gtgcgtaaaa ataaaataaa ataaacaaat
     351  tgaattatta acagtaattt gcaatttgca agttgcgatc acaattatat
     401  ttacaacttg tgatggatat tgatcattgt atgcctgtat ttgatatggc
     451  atatagcgac gataatcacc ttccttatta catacagaga tcgactcata
     501  atgtggttcg ggatgttgat tatactggtt ttatatgtta tcctttgcag
     551  gtcgatctta atgataatgt tgaggtcggt gctgatattt atcacatgaa
     601  gattaagact atgagactta atgtcgatat ttataacaat gatgatgttg
     651  ccacaaattt tccaggttgg gttaggttta ttgtgttttg tacacctcct
     701  gtgtcttctt gggttaatgg ctggtgctct agtctgtttt caccttttgt
     751  aggcgtgaat agtcttattg accctaaatt gttaaaacgt gatggycatg
     801  ggattactgt gttacatgat ggtatttatt gtttgcgcta tcaagaattt
     851  tttaccggaa gttttgagct caactttcgt ggacctggta attataccct
     901  aactaataat gtttgttggt cccccgctac tagtgtggat tctatatatg
     951  tggcttgtgt tgctagttgg tgtggtgata gtgcttttat gttgcagtcc
    1001  gatagtgtgg cttgggtaca caagagattt tggcaacgac ctgtgttgga
    1051  atttgggcaa tgtttagatg atctaccaga tcatgataat aataataatg
    1101  attgtggatg atcgtttgtg acgtccgaag acgttaaact acccgcatat
    1151  gcggtgttta cgggctcgtt tacaagcctc cttgctatgg taaggtttat
    1201  gtaaacacaa aaatatggct tattggttat gctaaacctc atatgttatt
    1251  aaataaggtt gagatgtact gactggatgt gaaatgtgcc agtcttcata
    1301  ggg