!!NA_SEQUENCE 1.0
ID   AF197558   standard; genomic RNA; VRL; 1725 BP.
XX
AC   AF197558;
XX
SV   AF197558.1
XX
DT   05-DEC-2000 (Rel. 66, Created)
DT   29-MAY-2003 (Rel. 75, Last updated, Version 2)
XX
DE   Beet necrotic yellow vein virus isolate N7 RNA 3 segment, partial sequence.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1725
RX   MEDLINE; 20456802.
RX   PUBMED; 11003469.
RA   Koenig R., Lennefors B.L.;
RT   "Molecular analyses of European A, B and P type sources of Beet necrotic
RT   yellow vein virus and detection of the rare P type in Kazakhstan";
RL   Arch. Virol. 145(8):1561-1570(2000).
XX
RN   [2]
RP   1-1725
RA   Koenig R.;
RT   ;
RL   Submitted (21-OCT-1999) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und Biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land und Forstwirtschaft, Messeweg 11, D
RL   38104 Braunschweig D 38104, Germany
XX
DR   SPTREMBL; Q9DS68; Q9DS68.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1725
FT                   /country="Netherlands"
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /note="almost complete sequence of RNA 3; lacks only a few
FT                   nucleotides at the 5'- and 3'-ends type: A"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="N7"
FT                   /segment="RNA 3"
FT   CDS             421. .1080
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9DS68"
FT                   /product="P25 protein"
FT                   /protein_id="AAG37098.1"
FT                   /translation="MGDILGAVYDLGHRPYLARRTVYEDRLILSTHGNICRAINLLTHD
FT                   NRTTLVYHNNTKRIRFRGLLCALHGPYCGFRALCRVMLCSLPRLCDIPINGSRDFVADP
FT                   TRLDSSVNELLVSNGLVIHYDRVHHVPLHTDGFEVVDFTTVFRGPGNFLLPNATNFPRP
FT                   TTTDQVYMVCLVNTVNCVLRFESELTVWVHSGLYIGDVLDVDNNVIQAPDGVDDDG"
XX
SQ   Sequence 1725 BP; 430 A; 303 C; 366 G; 625 T; 1 other;

AF197558  Length: 1725  January 7, 2004 15:41  Type: N  Check: 8216  ..
       1  tggtatttat ttaccctcag ttggtgatat atgtgaggac gctagcctgt
      51  tgggtttcct gaccgaccaa atccaagcga gcttaatcca agtacctcgt
     101  ctcaaattga gtgtcaagtg aataagcata gtgaccccat cgtttcaggg
     151  tagttgacgg ctattaatag acatattaca aacgcttctc tttatttatc
     201  accaacatgg gatgtaatgt ttatgcgtga gcctacggcc gcattgtaaa
     251  attagtggtt ttgaatttct attcttcgga atatacaagg tttaaaagac
     301  cagcatttgg gttaaaaatt tttaaacctt actatcttta actagtaact
     351  cgaactcgat ttatattcag attttaaata tcaagttgtt gtgttttctg
     401  atcatcatta agtgaccgtc atgggtgata tattaggcgc agtttatgat
     451  ttagggcaca gaccttacct agcacggcgt acggtttatg aggatcgttt
     501  gattcttagc acacatggta atatctgtcg ggctattaac ttgttaactc
     551  acgataatcg tactacactg gtgtatcaca ataatactaa acgcataagg
     601  tttcgtggat tattgtgtgc tcttcatggg ccttattgtg ggtttcgtgc
     651  cttatgtaga gtaatgttat gttctctacc tcgtttgtgt gacatcccta
     701  tcaatggatc tcgcgacttt gttgcagatc ctaccagact cgacagctct
     751  gttaatgagt tgctggtttc taatggtctc gtcatccact atgatcgtgt
     801  tcatcatgtt cccttacaca ctgatggttt tgaagttgta gatttcacga
     851  ctgtctttcg tggtcctgga aactttcttt tgcctaatgc aacaaatttc
     901  cctcggccaa ccacaaccga tcaggtttac atggtgtgtt tggtaaacac
     951  ggttaattgt gtgttacgtt ttgagtccga acttacagtg tgggttcact
    1001  ctggtttgta tataggtgat gttttagatg tggataataa tgttattcaa
    1051  gcccctgacg gtgttgatga tgatggttag agttatcaca atttcaacaa
    1101  cacacttatt ggtgtgttgt tctgttacac catttgaaag tttaataatt
    1151  gtctcaattc gattgttgat ctggttggga caattatttt attttctttt
    1201  ggtgtaatcg tccgaagacg ttaaactaca cgtgatttca cggtgttcga
    1251  tgagaagatt gtttaacggt gttacgttgt gtacctttaa gctttcttct
    1301  cattttacca catgtgatga ttgtagcctg tgggttgtta tgtggacaat
    1351  tatggttact tatttgtaaa tgataaagag tgtgcggtag ccgactttat
    1401  gcgagtggga gtagttgtgt tattnctact attctggttc gtataaagat
    1451  ccttgacggc ggcatcgtgg gttccacagc cggttacatg gtgttcccgt
    1501  ccgtttacga aggtttaact gtgagccttg tattttacaa atacacagtt
    1551  tttatcttaa caggctcgtt cacaagcctc cttttacatt aagtttaaag
    1601  gtttatgtgg acacaaaaat atggcttatt ggttatgcta aacctcatat
    1651  catgttataa tattcgtttc atattataat taaggttaag atgtactgac
    1701  tgggtgtgaa atgtaccagt ccttg