!!NA_SEQUENCE 1.0
ID   AF225953   standard; genomic RNA; VRL; 5951 BP.
XX
AC   AF225953;
XX
SV   AF225953.1
XX
DT   02-APR-2001 (Rel. 67, Created)
DT   29-MAY-2003 (Rel. 75, Last updated, Version 2)
XX
DE   Broad bean wilt virus 2 segment RNA1, complete sequence.
XX
KW   .
XX
OS   Broad bean wilt virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Fabavirus.
XX
RN   [1]
RP   1-5951
RX   MEDLINE; 21163980.
RX   PUBMED; 11266207.
RA   Koh L.H., Cooper J.I., Wong S.M.;
RT   "Complete sequences and phylogenetic analyses of a Singapore isolate of
RT   broad bean wilt fabavirus";
RL   Arch. Virol. 146(1):135-147(2001).
XX
RN   [2]
RP   1-5951
RA   Wong S.M., Koh L.H.;
RT   ;
RL   Submitted (19-JAN-2000) to the EMBL/GenBank/DDBJ databases.
RL   Biological Sciences, National University of Singapore, 10 Kent Ridge
RL   Crescent 119260, Singapore
XX
DR   GOA; Q997D0.
DR   SPTREMBL; Q997D0; Q997D0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5951
FT                   /country="Singapore"
FT                   /db_xref="taxon:76875"
FT                   /mol_type="genomic RNA"
FT                   /organism="Broad bean wilt virus 2"
FT                   /isolate="ME"
FT                   /segment="RNA1"
FT   CDS             228. .5837
FT                   /codon_start=1
FT                   /db_xref="GOA:Q997D0"
FT                   /db_xref="SPTREMBL:Q997D0"
FT                   /product="polyprotein"
FT                   /protein_id="AAK27841.1"
FT                   /translation="MDFSMMQMTVGFLKTSMGLQSIKDIVGKACVAEKDRTLLHIHLCF
FT                   FHANEMARDYNEGMDMEQIQSSAAIKYRAAVLKRHVVMNVETGRYDRARMMQYNNETCV
FT                   NWFSCRIIEEKAGEVLDEEEAQEDNIVENFLMKCAISEDVGQTSREGAEHYAFGQGLYE
FT                   YATRISDAIMAVISGSIKKSIDEFLDKVYTVMAQIFAAWMPRIRAAFQWFENIKEVIKR
FT                   WANTMHGKINFILVGMEDCLYMGAGLVAATCIVTLLEKFMIAIGILTKPCGAATLFLTT
FT                   AMAAISATYVCGKALEKSAMLTNLLHFVTTNCQVVLNTLFNHELGRQEQEMGRDDEKTP
FT                   TGLGQFGISTMLQDVANLVSTWSTSSVTETGKTFGAISQIKNGILALRDMVYFVFEKLS
FT                   ELAHRVLGFESQVLADLSILLGENVADWLSECDCMVAYMLEFNSRNREIFDRLSQLIEK
FT                   GRMIRTGVLRSSHRGSSQVMSLVTKALEKLIELHNSVVMAGSNTTRKSPFMVFFTGASG
FT                   TGKTSVVQRVAINWLQEEQLGTSEVYARNGQDPFWSGYKRHAVVTYDDFGAVPGTTSNE
FT                   AEIINVISRNPYATVMAGLAEKGMYFDSRLVLASSNFLAANPESGVHDSEAYERRRHAV
FT                   IRVSLKPGVPYNANDPCANQSYTLLESKTPFNEIQTFETYAELWSFLYTSFKEHEEQGE
FT                   LYLKSLPILDSDKKEALEGLVGLTVIATSFAPKAVMQFGAEKFPGYHFLISDGEYCYFW
FT                   HGDGSVKFVSVDRMKLGKQDIIQLKQQGLSTAMMYKDLAKAFPTLNSLAVLYAKNIVAK
FT                   RWIGADLEPTKSCEDVYMREQIGNLPKWQRAYLHVLSKYLTVQSPRGWFMECLEEAKRN
FT                   LRATYLWEYKQWPLPLKLALGSLIAIMAGGAIWYSLQSLWCVSGDASFIAGAATVFSVS
FT                   SFAGQSDVPSRDNTERSFRNRKIRARTWQGQSSCFGDSALWIAETCMATLTFSNVRTQV
FT                   CLAPGRGFFGVNHCLAVIPAGVMVKLDSSIGVTYFVWEKEKLIQFEGNEIALYMTSTMP
FT                   KTVDSLLSRIHFDAETLPKVFKAVFFSYKYDPVVQQMVPELGSVTCKVHNKAFTLAHGE
FT                   YRREIPQSITYEASTVAGDCGSLIMAEIGGKFKLVGMHVAFNGREGSASFMPYHALLDQ
FT                   QVGQGDFVLKYQEWAEPKILGPGCRAMGLIDPEHALAASGKTTFVETPEEWHLNYPCDK
FT                   LPSVLTRGDPRLAGTVHADYDPFAAGMSKYAREAGPFDAGSLKQVCLGITEVWEDASAD
FT                   FPMDEVDLDTAINGLEDVEFFDALVLGTSEGFPYRLDRGPGEKGKSRYVSGESGNFKIT
FT                   DEGVLSDINWFEETSKTQVPDLYCIECVKDERLPIRKVLHEPKSRLFTVLPMSYNIAIR
FT                   KKFLNFVRFFMKRRDVLPAQVGVNPYSREWTRIANKLLSKGNNVLCCDYSRFDGFLPKC
FT                   VMNEIGEMIARVMRASDESRTQIKNLMLACTSRYAMCNRILYRVENGIPSGFPLTVVVN
FT                   SILNEILVKYAYWHCFADNPTVQSNFDAHVSMVVYGDDNLISVSDAISSKFDGNFLVKF
FT                   MEGLGIKVTDGIDKTKIGIEFRRLENCDFLKRSFKMNPDGTWRCPMSKESLWPQLHYVK
FT                   AKKLEMAEAYINNCNNILRELWLHDVAEAKEFRNRVLRNLKWIGHEQLLNMQQLAVFHS
FT                   EQMNGASDFLSTCVTVDSISLMDPLAPGLLPVKTCEVIPRIFVAAEKHFEGNFEDFFTV
FT                   SITTSRKFKEDKGFVLLFPYGAGRGGLPTTQFMKENVVRKGCAIQKKYKQAYERGEKIL
FT                   FISQSSVVPAYVFAVMLLHSIGAISRLTSNKALTQAMRTCKKLEYLPKEYEDFF"
XX
SQ   Sequence 5951 BP; 1699 A; 1021 C; 1530 G; 1701 T; 0 other;

AF225953  Length: 5951  January 7, 2004 15:41  Type: N  Check: 4379  ..
       1  ttttaataaa atattgaaac aaacagcttt cgttccgaaa acagctttca
      51  gttactaatc agctttcgtt ccgaacaaac agctttcaaa caaacagctt
     101  tcatttcatt tagcctttcg tggtttgtgt gacttctaag agaacccgga
     151  aaaagggagt gtgattaaaa gcgcaccata tatttcgaag atcattttga
     201  atttcatttt gctaccttaa ttttgagatg gatttcagta tgatgcaaat
     251  gaccgtgggt ttcctcaaaa cttcaatggg tttacaatcc attaaggata
     301  ttgtgggaaa agcttgtgtg gcagagaagg atagaacctt gctccacatt
     351  catttatgtt tcttccacgc caatgagatg gctcgggact acaatgaagg
     401  tatggacatg gagcagatac aaagttctgc tgcgatcaaa taccgagctg
     451  cagtgttaaa gcgccatgtt gtgatgaatg tggagacagg aagatatgat
     501  cgtgcacgca tgatgcagta caacaatgaa acgtgtgtca attggttctc
     551  gtgcaggatc atcgaagaga aggctggaga agtgcttgat gaagaggagg
     601  cacaagagga taatattgtt gaaaattttc ttatgaagtg tgcgatttct
     651  gaggatgttg gtcagacgtc aagggaaggt gctgagcatt atgccttcgg
     701  ccagggattg tacgagtatg ctactcgtat tagtgatgca ataatggcag
     751  ttatttcagg ctccattaaa aagagtatag atgaatttct ggacaaagtg
     801  tatacagtca tggcgcagat ttttgcggct tggatgccta gaattagagc
     851  cgcgtttcaa tggttcgaaa acattaagga agtcatcaaa aggtgggcca
     901  acacgatgca tggaaaaatc aatttcattt tggttggcat ggaagattgc
     951  ttgtacatgg gcgctggact cgtggcagcc acttgcatag ttacattgct
    1001  tgagaaattc atgattgcaa ttgggatttt gaccaaacct tgtggggcgg
    1051  caactctttt cttaacaact gcaatggcgg ctatttcagc tacatatgtg
    1101  tgtgggaagg ctttggaaaa atcagccatg ctcacaaact tgttgcattt
    1151  tgtaactacc aattgccaag ttgtgttgaa tacgctattc aatcatgaat
    1201  tgggaaggca ggagcaggag atgggccgag atgatgagaa aaccccgaca
    1251  ggtcttggcc aatttggaat ttcaacaatg ctacaagatg tagccaattt
    1301  agtttcaacg tggtcaacaa gttcggtcac agaaactggg aaaacatttg
    1351  gggccatttc tcagattaag aatggaattt tagctttaag ggatatggtg
    1401  tacttcgtgt ttgaaaaatt gagtgagttg gctcatagag tgcttgggtt
    1451  tgaatctcaa gtactggctg acctgtcgat tttgcttggc gaaaatgtgg
    1501  cagattggtt atctgaatgt gattgcatgg tggcttatat gctcgagttt
    1551  aactccagaa atagggagat ttttgataga ctgtctcagc taatagagaa
    1601  aggcagaatg ataagaacag gagttttgcg atcaagtcat cgtgggtcgt
    1651  ctcaggtcat gtcgcttgtt accaaggctt tggagaaatt gatagagctg
    1701  cataattcag tggtgatggc aggttcaaat acaactagaa agtctccctt
    1751  tatggtgttc ttcacaggtg cctctggcac agggaaaacc tcagttgttc
    1801  aaagggtcgc cataaattgg ctgcaagaag aacagcttgg gacgagtgag
    1851  gtatacgctc gcaatgggca ggatcctttt tggtctggct acaaaagaca
    1901  tgcggttgtc acgtatgatg atttcggggc tgttccaggc acgacttcaa
    1951  atgaagctga aattatcaac gttatttcaa gaaacccata tgcgacagtt
    2001  atggcaggtt tggcggagaa agggatgtac tttgactcaa gactggtttt
    2051  ggctagcagt aattttcttg ctgccaaccc ggagtcagga gttcatgatt
    2101  cagaggcgta tgagagacga aggcatgcag tgataagagt ttcattgaaa
    2151  ccaggagttc cttacaatgc caatgatccg tgtgccaatc aaagttacac
    2201  tctgttagag tccaaaacgc ctttcaatga gattcaaact tttgaaacgt
    2251  atgcggagct ctggtctttc ttgtacacaa gctttaagga gcacgaggaa
    2301  caaggggagt tgtatttaaa atccttgcca atattggatt cggacaaaaa
    2351  ggaagctctg gagggtttag tgggtcttac ggttatagcc acttcatttg
    2401  ccccaaaggc agtcatgcag tttggggcag agaagtttcc tggataccat
    2451  tttctcattt cagatggtga atattgctat ttctggcatg gagacggatc
    2501  agtgaaattt gttagtgtag acaggatgaa attgggcaag caagacataa
    2551  ttcagttgaa gcagcaagga ctgtctacgg ccatgatgta taaagatttg
    2601  gctaaggctt ttcccacttt gaattcattg gctgtgctgt atgcaaaaaa
    2651  tatcgtggca aaacgctgga ttggtgctga cttggagcca acaaaaagct
    2701  gtgaagatgt gtacatgcgt gagcagatag gcaacctgcc caaatggcag
    2751  agggcgtatt tgcacgtgct cagtaagtat ttaacagtcc aaagcccccg
    2801  aggatggttt atggagtgtc tggaagaagc aaagaggaac ttgcgggcaa
    2851  cgtacttgtg ggaatacaag caatggccat tgcctttgaa gctggcattg
    2901  ggttcattaa ttgccatcat ggcaggtgga gccatttggt attcgctaca
    2951  gtctttatgg tgtgtgtctg gggacgcttc ttttatagca ggagcagcaa
    3001  cggttttttc tgtttcctcc ttcgctgggc aaagtgacgt gccaagtcgg
    3051  gacaacacag aaagatcatt cagaaatagg aagattcgtg ctagaacatg
    3101  gcaaggccag agttcgtgtt ttggagactc ggcactttgg attgcggaaa
    3151  cttgcatggc aacattgact ttttcaaatg tgagaacaca agtttgttta
    3201  gcacctggga gaggattctt tggagtgaac cattgtttag ctgttattcc
    3251  cgcaggtgta atggttaaat tggattcaag cataggagtg acttattttg
    3301  tgtgggaaaa ggaaaagtta atacagtttg agggcaatga aatagcattg
    3351  tatatgacta gcacaatgcc caaaaccgta gattctcttt taagtagaat
    3401  tcattttgat gctgaaactt tgcccaaggt ctttaaagca gttttctttt
    3451  cttacaagta tgacccagtg gtccagcaaa tggtgcctga gttgggaagc
    3501  gtcacgtgca aggttcacaa caaggctttt acactggcac atggagagta
    3551  taggcgggag attccccaga gcattacata tgaggcgagt actgtggcag
    3601  gagattgtgg ctctttgata atggcggaaa ttggagggaa attcaagctt
    3651  gtgggaatgc atgtggcatt caatggcagg gaaggaagtg ccagttttat
    3701  gccgtaccat gctcttttgg atcagcaagt gggtcaagga gattttgtgc
    3751  tgaagtacca agaatgggct gagccaaaga ttttgggtcc aggttgcagg
    3801  gcgatgggac ttattgaccc agaacatgcc ttggcagcta gcgggaagac
    3851  aacattcgtt gaaaccccag aggaatggca tttgaattat ccatgcgata
    3901  aacttcctag tgttttaaca aggggtgatc ccagattggc aggcacagtt
    3951  catgctgatt acgatccgtt tgctgcaggt atgagcaagt acgcacgaga
    4001  ggcaggacct tttgatgctg gcagcttgaa acaagtgtgt ctgggaataa
    4051  ctgaagtatg ggaagatgct tcagcagatt ttccaatgga tgaagtagac
    4101  ttggacactg ctatcaatgg cttggaagat gtcgaattct ttgatgcttt
    4151  ggttttaggg acatctgagg ggtttcctta tcgcctagat cgtggtcctg
    4201  gcgagaaagg aaagagcaga tatgtatctg gtgagagcgg aaatttcaaa
    4251  atcactgatg aaggcgtgct ctcagatatt aattggttcg aggaaacaag
    4301  taagactcag gtgcctgatc tttattgcat tgaatgcgtc aaggatgagc
    4351  gcttaccaat cagaaaagtg ttgcatgagc ccaagagtcg actattcaca
    4401  gtgcttccaa tgtcttacaa catagccata aggaagaagt ttttgaactt
    4451  cgttaggttt ttcatgaaaa gaagagatgt tttaccagcc caagttggtg
    4501  tcaatcccta ttcgcgggaa tggactcgaa tagctaataa attgttgagc
    4551  aaaggtaaca atgttctgtg ttgtgattat agcaggtttg atggctttct
    4601  gcccaagtgt gtcatgaatg aaatcgggga aatgattgcc agagttatgc
    4651  gagcaagtga tgagtctagg actcaaataa agaatcttat gcttgcatgc
    4701  accagccggt atgccatgtg caaccgaatt ttgtacagag ttgagaacgg
    4751  tatcccttct ggctttccgc tcaccgtcgt tgtgaattcc attttgaatg
    4801  aaatcttggt caagtatgcg tattggcatt gctttgcgga taacccaact
    4851  gttcaaagca attttgatgc gcatgtttcc atggtggtgt acggtgatga
    4901  caatttgata tcagtttcag acgcgataag ttcaaagttt gatggaaatt
    4951  tccttgtgaa gttcatggaa ggacttggaa ttaaagtgac tgatggaatt
    5001  gataaaacaa agattggaat agaatttcgc cgcctggaga attgtgattt
    5051  cttgaaacga tcttttaaaa tgaatccaga tggcacatgg cgctgcccta
    5101  tgtctaagga aagcttatgg ccacagttgc actatgtgaa agcaaagaaa
    5151  ttggaaatgg ccgaggctta cataaacaat tgcaacaata tcttgcgtga
    5201  gttgtggttg catgatgttg cagaggccaa ggaattccgc aatagagtgt
    5251  tgagaaattt aaaatggatt ggtcatgagc aattactcaa catgcaacaa
    5301  ttggcagtgt ttcatagtga acagatgaac ggagctagtg attttctatc
    5351  cacttgtgtg acagttgata gcatttcatt gatggatccc ctagctccag
    5401  gtttgctacc tgtaaagact tgtgaagtga ttccccgaat ctttgtagcg
    5451  gcagaaaagc actttgaagg gaattttgag gatttcttca cagtgtccat
    5501  aaccaccagt cgtaaattca aggaggataa gggatttgtt cttttgttcc
    5551  catatggggc aggtagaggc gggttgccga cgacgcaatt catgaaagaa
    5601  aatgtggtga ggaaaggatg tgccatacag aagaaatata agcaggcata
    5651  tgagagagga gagaagattt tgttcatttc acagagctca gtggttccag
    5701  cttatgtatt cgctgtcatg ctgcttcatt caatcggagc aatttccagg
    5751  ctaacgagca ataaagcact cacacaggca atgcgaactt gtaagaaatt
    5801  ggagtacttg cccaaagagt atgaagattt cttttgaatt caattttatt
    5851  gaattatgtg tatattttat gtattaatca ctacttatat tgtataatat
    5901  gtattataca gggttgaaat gcctttcccg gattaatttc agtagtgagg
    5951  g