!!NA_SEQUENCE 1.0
ID   AF225954   standard; genomic RNA; VRL; 3607 BP.
XX
AC   AF225954;
XX
SV   AF225954.1
XX
DT   02-APR-2001 (Rel. 67, Created)
DT   29-MAY-2003 (Rel. 75, Last updated, Version 2)
XX
DE   Broad bean wilt virus 2 segment RNA2, complete sequence.
XX
KW   .
XX
OS   Broad bean wilt virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Fabavirus.
XX
RN   [1]
RP   1-3607
RX   MEDLINE; 21163980.
RX   PUBMED; 11266207.
RA   Koh L.H., Cooper J.I., Wong S.M.;
RT   "Complete sequences and phylogenetic analyses of a Singapore isolate of
RT   broad bean wilt fabavirus";
RL   Arch. Virol. 146(1):135-147(2001).
XX
RN   [2]
RP   1-3607
RA   Wong S.M., Koh L.H.;
RT   ;
RL   Submitted (19-JAN-2000) to the EMBL/GenBank/DDBJ databases.
RL   Biological Sciences, National University of Singapore, 10 Kent Ridge
RL   Crescent 119260, Singapore
XX
DR   GOA; Q997C9.
DR   SPTREMBL; Q997C9; Q997C9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3607
FT                   /country="Singapore"
FT                   /db_xref="taxon:76875"
FT                   /mol_type="genomic RNA"
FT                   /organism="Broad bean wilt virus 2"
FT                   /isolate="ME"
FT                   /segment="RNA2"
FT   CDS             206. .3400
FT                   /codon_start=1
FT                   /db_xref="GOA:Q997C9"
FT                   /db_xref="SPTREMBL:Q997C9"
FT                   /product="polyprotein"
FT                   /protein_id="AAK27842.1"
FT                   /translation="MNPELVAALDRYLSEIASSLFLGWIINLFLVFFYSSKSCFLLWAA
FT                   FLYVNYYILRFEFAYIVVPFLETIYSNSSQYHTVDWENAYTARSKSLWEQITDYNYCFN
FT                   FPKPVVEGFVSDFSPRFALEELIAMNEANITPVHTIPREILLKKASDYKLAVESKKSIL
FT                   PKVQDLYEMDKWHALRSRLSKNAPNYVVPSEIAVGAMSGAGNVKLALPVVEKYTEEVAD
FT                   DRLPDKVRSKADQIMVAAIELVADGFASVNSDVTMAGALYDKRHKTIASSFKGAFASRA
FT                   SGVPSHVIYYPMHRVPSNDDPNTTLELSMVSRDSDFDEGFTLANISVRTLYVRAKGPEK
FT                   VTETRHLLKAKTEDVVKAQQFASEAQVVFATPRLFPEVNLNNYNLPGPSNVQQTEAITT
FT                   NGGILFPKPKFKGNEVVLNYTGPTRVGNVSAQRPEKREFSSKSHVGSTDDLGCLSDEDG
FT                   RDYRHGQGLMEEDVLDVQTNNFAIESATETMRLLFSGCASIPLNVIPGTKLTVAYLNEL
FT                   SKHNAVHTGLLNMLSKVPGSLKVKINCQVAPTCGIGLAVSYVEGNESVNLGSSLGRLLG
FT                   IQHYKWNPAIEPYVEFVFKPFSCADWWNMHYLGSCKYAPVMVVQTLSKWLNAPKVDAKM
FT                   SFAIYYEPNVILPKQIATLDHAPAFMFRKELGTLAFKQGERAAYSFEVNFGKPQTDGKE
FT                   VTSTFASSYCGLSQYMQSDVILDFTLMSSPMIGGTFSVAYVAGAYIEKVGDMQILDSLA
FT                   PCDFTFSSGTKSTRSVRFPKEIFGVLQALDRWDLNSARGDDVSGNFVIYQRDAVSSALE
FT                   GELTFRIAARLSGDIDFVGVSAGYPTTITRIGKGKTQGRSLGPEIRKPLRYMLGQSHST
FT                   PLDFSSVRFVMGHWKYKAGLYPGSKSDEDIHPYSLKMRLDGSKSSENFEIIHSPFVRLL
FT                   QNCAWMKGTLNFYVVARASSDYMSYRRTSQLTVSAHENSLSSNQFYSGVLTSPSGELGF
FT                   SREIVGPVDGFASMGWNVRGSKKFYKIHVEMGNVHEYETVTLYGRFGPNVEFAGQQKGG
FT                   HYMLEKEAPTFKALKY"
XX
SQ   Sequence 3607 BP; 995 A; 663 C; 867 G; 1082 T; 0 other;

AF225954  Length: 3607  January 7, 2004 15:41  Type: N  Check: 4235  ..
       1  tgttttaata aaatattaaa acaaacagct ttcgttccga aaaacagctt
      51  tcaaatttca aacagctttc agacactctg gaattttcag attgaacccg
     101  gaaaaaggga gtgtgattta aagcgcacca tatcatttga aaatttcgtt
     151  ttgatttcta tgttctttgc taaggttgtt tatgtgagta tgagttcttg
     201  ttgtgatgaa tcctgagttg gttgccgcat tagataggta tctatctgaa
     251  attgcaagca gtctattttt gggttggatt ataaatcttt tcttagtttt
     301  cttttactct tctaaaagtt gttttttatt gtgggccgca tttctttacg
     351  tcaattatta catattgaga ttcgaatttg catatatcgt tgtgcccttc
     401  cttgaaacga tatactcaaa tagttctcaa taccacactg ttgattggga
     451  gaacgcttac acggcgcgtt ccaaaagctt gtgggaacaa ataactgatt
     501  acaactactg ttttaatttc ccaaaacccg ttgtggaagg ctttgtgtca
     551  gatttttcgc ctcgtttcgc acttgaagag cttattgcta tgaacgaggc
     601  aaatattact ccagtccaca caatcccgag agagatcttg ctcaaaaaag
     651  caagtgacta taaattggct gtggagagta aaaagtccat actgccaaaa
     701  gttcaagact tatatgagat ggacaaatgg catgccttga gaagtaggtt
     751  gagcaagaat gcgcccaatt acgttgtacc ctcagagatt gcagttgggg
     801  ccatgtcagg tgctggaaac gtgaaattgg cgctgcccgt ggtggaaaaa
     851  tacactgaag aagtggcaga tgatagattg cctgacaaag ttcgctccaa
     901  agccgatcaa ataatggttg cggccattga attggtggca gatggctttg
     951  cctcagtcaa ttctgatgtt actatggcag gtgcgcttta tgataagcgc
    1001  cacaaaacaa ttgctagttc tttcaaaggt gctttcgcat ccagggcaag
    1051  tggagtccca tctcatgtta tttattatcc aatgcatagg gttccttcga
    1101  atgatgatcc taacacaacc ttagagcttt caatggttag tcgtgactct
    1151  gattttgatg agggtttcac gttggctaat atctcagtac gtactttgta
    1201  tgttcgtgca aaaggacctg aaaaggtgac ggaaacaagg catctcttga
    1251  aggctaagac cgaagatgtg gtgaaagcac aacaatttgc gagtgaggca
    1301  caagttgtat ttgccacccc tcggctattt cctgaagtca atctgaacaa
    1351  ttacaattta cctggaccta gcaacgtgca gcaaacagag gcaatcacca
    1401  ccaatggagg aattcttttc ccgaagccaa aatttaaagg gaatgaagtg
    1451  gtgctcaact acacagggcc aacgagagtt ggaaatgtta gtgcgcagag
    1501  gcctgagaag cgagagttca gcagcaaatc acatgtggga agcactgatg
    1551  atcttggatg tctgtcagat gaggatggca gagattatag acatggtcag
    1601  ggtttgatgg aggaggatgt tttggacgtt cagactaaca attttgccat
    1651  tgagtctgcc acagagacta tgcgcttgtt gtttagtggt tgcgcaagta
    1701  ttcctctgaa cgttatacct gggacgaagc ttacagtggc ctatttaaat
    1751  gaactatcca agcataatgc tgtgcacact ggattgttga atatgcttag
    1801  caaagttcca ggttctttga aggtcaagat aaattgccag gttgctccca
    1851  cttgcgggat tggattggca gttagctacg tcgaaggcaa tgaaagcgtg
    1901  aacttgggat ctagcctggg gcgcttgttg ggtattcagc attacaagtg
    1951  gaatccggct atagagcctt atgtggaatt tgttttcaag cccttctcct
    2001  gcgcagattg gtggaatatg cattatttgg ggtcatgtaa gtatgcaccc
    2051  gtgatggtcg ttcaaacatt gtccaaatgg ttgaatgctc caaaagtgga
    2101  tgccaagatg agcttcgcca tttattatga acccaatgtg attttgccca
    2151  agcaaatagc gaccttggac cacgccccag cgttcatgtt ccgcaaggaa
    2201  ctggggacgc tagcttttaa gcaaggggag cgggcagcat attcttttga
    2251  agttaatttt ggcaaacctc agacagatgg aaaggaagtg acttctactt
    2301  ttgcctcatc ttattgtggt ttgagtcagt atatgcaatc tgatgtgatt
    2351  ttagatttta ctctcatgag cagtcctatg attggaggca ctttttcagt
    2401  tgcatatgtt gcaggggcat atattgagaa agttggtgac atgcaaattc
    2451  ttgattcatt ggccccatgt gatttcacat tttcttcagg taccaagagc
    2501  acgcgttccg tgcgatttcc gaaagagatt tttggggtgc ttcaggcgtt
    2551  ggataggtgg gatttaaact cagcaagggg agatgatgtt tcaggcaatt
    2601  ttgtgattta ccaaagagat gcagtctcaa gtgctcttga aggggaatta
    2651  acgttccgaa ttgctgctcg tttgtctggg gacatcgatt ttgttggtgt
    2701  tagtgcaggc tatccaacaa caattacacg gattggcaaa ggcaagacgc
    2751  aaggaagatc gcttggtccc gaaatcagaa agcctttaag gtacatgctt
    2801  ggccagtccc attcaacacc attggatttt agttcagtgc gctttgtaat
    2851  gggtcactgg aagtacaaag ctggtttgta tccagggagt aaatcggatg
    2901  aagacattca cccatattcc ctcaaaatgc gccttgatgg ctcaaagagc
    2951  agcgagaatt ttgaaattat ccattcccct tttgttcgat tattgcaaaa
    3001  ttgtgcatgg atgaaaggaa ctctgaactt ttatgttgtg gcacgagcaa
    3051  gctctgatta catgagttac agaaggacct ctcagttgac agtctcagct
    3101  catgagaata gtcttagctc caaccaattc tacagtggag tcttgacaag
    3151  ccctagtggt gagttagggt tctccagaga gattgtaggt ccagttgatg
    3201  gttttgcatc catgggctgg aatgtgcgag ggagcaaaaa gttttataaa
    3251  attcatgtag aaatggggaa tgttcatgag tacgaaactg tgacgctata
    3301  tgggcgattt ggtcctaatg tggagtttgc tggccagcag aaaggtggtc
    3351  actatatgct tgagaaggaa gctccgacat ttaaggcact caaatattga
    3401  aaacaaattt gttctctctg tgtgtgtgct caaataaaag ggcgtgggtc
    3451  actagccccc cattaaaatg ggttccatga cctgttattt tcagaaaatt
    3501  ttattgtgtt ttaagtatat ttttatgtat aaatcactac ttatattgta
    3551  taatatgtat tatgcagggt tgaaatgcct ttcccaagta aatttcggta
    3601  gtgaggg