!!NA_SEQUENCE 1.0
ID   BSJ002234  standard; circular genomic DNA; VRL; 7389 BP.
XX
AC   AJ002234;
XX
SV   AJ002234.1
XX
DT   02-JUN-1998 (Rel. 55, Created)
DT   26-MAY-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Banana streak OL virus coding regions
XX
KW   .
XX
OS   Banana streak OL virus
OC   Viruses; Retro-transcribing viruses; Caulimoviridae; Badnavirus.
XX
RN   [1]
RP   1-7389
RA   Harper G.;
RT   ;
RL   Submitted (18-NOV-1997) to the EMBL/GenBank/DDBJ databases.
RL   Harper G., Dept of Virus Research, John Innes Centre, Colney Lane, Norwich,
RL   NR4 7UH, UK.
XX
RN   [2]
RX   DOI; 10.1023/A:1008021921849.
RX   MEDLINE; 99125225.
RX   PUBMED; 9926402.
RA   Harper G., Hull R.;
RT   "Cloning and sequence analysis of banana streak virus";
RL   Virus Genes 17(3):271-278(1998).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7389
FT                   /db_xref="taxon:328671"
FT                   /mol_type="genomic DNA"
FT                   /virion
FT                   /organism="Banana streak OL virus"
FT   CDS             517. .1050
FT                   /db_xref="InterPro:IPR010746"
FT                   /db_xref="UniProt/TrEMBL:O72698"
FT                   /gene="ORF1"
FT                   /product="small protein of unknown function"
FT                   /protein_id="CAA05262.1"
FT                   /translation="MVEKTWDQKFQEFLNSSELTQAQLEYLDLATEAKVSNKDLAHNLH
FT                   INTYRLSLTGKVLWTSGRKNRDLLVQIIGEQEAQKKDLLELQNLSKIVRSQRNDLKKAH
FT                   EKLDVLSDELKALRKDYLKRRPLSKEDVEELVLRISEQPKFIEKQTEALTEELTKEVQN
FT                   LKKIIHDFERKLMG"
FT   CDS             1047. .1451
FT                   /db_xref="UniProt/TrEMBL:O72699"
FT                   /gene="ORF2"
FT                   /product="small protein of unknown function"
FT                   /protein_id="CAA05263.1"
FT                   /translation="MSNSITSSAVYQQAIAGTTGDWESPGVGISDRGSVNNTQLTRQLN
FT                   TIIFLCTKTQQEVLALKDTVADIQNRLRILERTGATSAGTPQLKGEIDAINEKLSRIQQ
FT                   IQGSQPRKDGGTAATSKVFQDPYKLLRNLK"
FT   CDS             1451. .6949
FT                   /db_xref="GOA:O72700"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="UniProt/TrEMBL:O72700"
FT                   /gene="ORF3"
FT                   /product="polyprotein, cleavage products include viral coat
FT                   protein and proteins with homology to an aspartic protease,
FT                   reverse transcriptase and RNase H"
FT                   /protein_id="CAA05264.1"
FT                   /translation="MAQRPRITGSRTTTAEEGTPLIDDQIREYRSSRRAAYEAQRIARQ
FT                   TGNIIGRVVGRQPREHTLSMVVDPNSELSRSLAHRARTVPGEVLYMTQRDSPVNRIYRN
FT                   RTEERMLVTNGQQDRSFIYQESFEELASAGFEYIHLGVLQVRIQIMHRTYAGTMALIVF
FT                   RDTRWTQEGEEGRSIIGAMEADLSQGHQLIYVIPDIMMTIRDFYQHVQISILTKGYQGF
FT                   QGEANLLITRSCRCRLTNVPNVGFAYNIQRVVEYLNSKGVKAIQAQKLSTTKYQGTEWN
FT                   IKPSNVVVPMQPTNLITRVNYDNSRSIRFGNYQASTSSAPPKYNEDGDSDDDIQATIEH
FT                   VNMLYIEDTSDTDYPVMAAEEEIFPLENMVGEDDIISQFLENLDITDDEEDSRSQYVMN
FT                   LEDNEEFPQLREIEKVLSSVAETAISSYRPPDAEMGEEAPAYAPATSATGWAGSRPFPF
FT                   MPKGGPRRWDSNNEFYSLPPAQSRQGAMFVMPMDFDIKVFERWESITLLHMTEKIFDNA
FT                   DDKMRYMENLLGEDEKKHFIEWRMKYTAEYETMKAQALGDQGTQNIINQIRLIFFLENP
FT                   QVGTTTSQDAAYKTLKSLVCTEMTDTAIYRYMNDYFHLSAKTGRAWASEELSKEFFTKL
FT                   PRGLGDEVEKAFMEKHPSNTVGITARITFTKRYLKELCEKVALQKSIGKMDFCRSTPVH
FT                   GLYRDKSYRKYGARKSTSYKGKPHKSHVRIGKKKYLSLRKKNCRCYACGEEGHFASECK
FT                   NPRKIMDRVKVLDSLDLEDGLDVISVGFDEDDVSDIYSIDEEADNYRFTNEEMEGFKNY
FT                   EVYMLRMEEMDEPREYLVGEPSEWRSKMKVSRRQYFCKHEWKFEETHVTICKACGSEAA
FT                   PKHRIDCLKCEMTVCLMCQPWFYKNVNTEEVKKTRVRIERVIDWKDIALKQHEVLKTSI
FT                   ANEKQLSEEVEILRKQSKELKEKEPIIFEEDTEETAQLIQKLEDVERENELLNILIKQK
FT                   EKDEIQYLNEIIELKERIKDLEQQQKDKEEQVNVLEEVSINALRPRNNHLNIKCEIEVK
FT                   NKKVVLNAILDTGATVCVADERMIPSGMKEQAKNKIIIRGVNGVTEVNEVTSAGKLWVG
FT                   KQWFYLPQTFIMPSLADGVHMIIGMNFIRTVGLRIENGEVTIYKIMTTVQAPPIVHELN
FT                   YIDELELELHEYYNICAAESSRGEISEEFISPDIIGKMKKLGYIGEEPLKHWEKNQVKC
FT                   RIEVKNPDMIIEDRPLKHVTPTMKETMAKHVQKLLELKVIRPSSSKHRTTAMIVESGTE
FT                   VDPMTGKERRGKERLVFNYKRLNDNTEKDQYSLPGINTIIKRIGNAKIYSKFDLKSGFH
FT                   QVAMDPESIPWTAFWAIDGLYEWLVMPFGLKNAPAIFQRKMDNCFRGTEDFIAVYIDDI
FT                   LVFSETIHQHKEHLKKFMTICEKNGLVLSPTKMKIGTRQIDFLGATIGNSKIKLQPHII
FT                   KKIIEMKDEELKEVKGLRKWLGILNYARSYIPKLGKILGPLYAKTSPNGERRMNTQDWK
FT                   IVKEVKEVVANLPELELPPEKAIMIIETDGCMEGWGGVCKWKTDSLQPRWSEKICAYAS
FT                   GKFTPIKSTIDAEIQAVINSLDKFKIYYLDKKELIIRTDSQAIVSFYKKSSDHKPSRVR
FT                   WLAFTDYITGTGLEIKFEHIDGKDNVLADTLSRLVKIILHPEKHQSEGVLINAVEEVFH
FT                   KGNTDAKQRVNDVVKRYEDWLSKGYRLHQINVLTLSEEPVFKCGCNKPAKLKISRTSRN
FT                   PDREFYSCETNTCFTWVWKDQIDSFVQEKIRWEKKLEEISEDSLWEELLREQENLRAEQ
FT                   EYLIEDALDLLDISNDD"
XX
SQ   Sequence 7389 BP; 2618 A; 1357 C; 1681 G; 1733 T; 0 other;

  AJ002234  Length: 7389  June 7, 2005 08:32  Type: N  Check: 1639  ..
       1  tggtatcaga gcaaggttcg tttttatggc tttcatgggg taattccttt
      51  agataggagc cgaagggctc tgcttttctc taattgagtt acaagtttat
     101  gatttaaatt gtttaaattg gagctgtatt cagtctttct tagaaaaatg
     151  agcatgattt cgattatagc tggtcaaggc tgtagggaaa aatgattatg
     201  ttttatgcta gttggtccaa gagagcatgc ctacccaaga aaaagtaccc
     251  gaagagaatg ggggaaaaat tggttcttcg catgtatgag gataatatcc
     301  tagaaacaga acataacctg cgtgaagtac ttacaaagcc aagataatat
     351  cctatataga aacatgggca tcgtgaagta taagactgac tgaactacaa
     401  gctcctttat aaacaaaagg atcatagacc tctgtacgtc aatacgggtt
     451  aagcatcctg gaggagtact cctatctagt ttacgaaaag aaagtcattc
     501  accttgcata caatttatgg tcgagaaaac ttgggatcaa aaattccagg
     551  aatttctaaa ctcatctgaa ctcactcaag ctcaacttga gtatcttgac
     601  ttggcaacgg aagccaaagt ctcaaacaaa gatcttgctc ataatttgca
     651  catcaacact tatcgactaa gccttacagg gaaggtcctt tggacttctg
     701  gaaggaaaaa tcgggattta cttgtgcaga taatcggtga gcaggaggct
     751  caaaagaagg acttattgga gttgcagaac ttaagtaaga ttgtgcgcag
     801  ccagcgtaac gatcttaaga aggctcacga aaagctggac gtcttgtctg
     851  atgagcttaa agctctcaga aaggactatc tgaagaggcg ccccttgagc
     901  aaagaagacg ttgaggaatt agttttgcgt atctctgaac aacctaagtt
     951  catagagaag caaactgagg ccttaactga ggagctgact aaagaagttc
    1001  aaaatctgaa aaaaattatt catgactttg agcgaaagct catgggatga
    1051  gtaattctat cacaagctct gcagtatacc aacaagcaat tgctggaaca
    1101  actggtgact gggaatcccc tggagtaggg atatctgacc gtggatcggt
    1151  gaacaacacc cagctcacaa gacaactcaa caccattata ttcctgtgta
    1201  caaagacaca acaggaagtc ttagccttaa aagacacagt agcggacatc
    1251  caaaaccgct tgagaatact tgaaaggacc ggtgcaacat cagccggtac
    1301  cccacaactt aagggtgaaa ttgacgccat caacgagaag ttatcaagaa
    1351  ttcaacaaat tcaagggagt caaccaagga aagacggtgg tactgcggcc
    1401  actagcaaag tatttcaaga cccctacaaa cttctcagaa atttgaagta
    1451  atggctcaaa gacccagaat taccggatca agaaccacca ctgctgaaga
    1501  agggacaccc ttaattgacg accaaataag ggaatataga agctccagaa
    1551  gagcagcata cgaagcccaa cgaattgcca ggcagaccgg caatattatt
    1601  ggaagggttg taggacgaca accccgggag catacactat ctatggtggt
    1651  agacccgaat tcggagctca gcagaagtct tgcccacaga gcaagaacag
    1701  taccaggaga ggtactatat atgactcaac gagacagtcc tgtaaataga
    1751  atttacagaa acaggacaga agaaagaatg ctcgtaacca acgggcaaca
    1801  agatagatct ttcatatatc aagaatcatt tgaggagcta gcctcagcag
    1851  gatttgagta catccatctg ggtgtattac aagtcaggat ccagatcatg
    1901  cataggacat atgcaggcac gatggcctta atagtctttc gtgatacacg
    1951  atggactcag gaaggagaag aaggcagatc cattattgga gctatggagg
    2001  ctgatctgtc acaaggccac caactaatct acgtcatccc ggatataatg
    2051  atgaccataa gggatttcta ccaacatgta caaatcagta tcctaactaa
    2101  gggataccag ggattccaag gtgaagcaaa tctgctgatt accaggagct
    2151  gtagatgcag actcaccaat gttcccaacg tcggattcgc ctataatatt
    2201  caaagagtag tggagtactt aaactccaaa ggcgttaaag ctatacaagc
    2251  tcagaagctg agtacaacaa agtatcaggg cactgaatgg aacatcaagc
    2301  cctccaatgt ggttgtacca atgcaaccaa cgaatttgat caccagagtc
    2351  aactacgaca actcacggag tatacgattt ggtaattatc aagcaagcac
    2401  atcctcagcg ccaccaaaat acaacgaaga tggagattca gatgatgaca
    2451  tccaagccac aatagagcat gttaacatgc tttatattga agatacatct
    2501  gatactgact atccagtcat ggcagctgaa gaggaaatct ttcctcttga
    2551  aaacatggtg ggagaagatg acattatctc ccaatttttg gaaaatttgg
    2601  atatcacgga tgatgaggaa gattccagat cacaatacgt gatgaatctg
    2651  gaagacaatg aagaattccc acaactcagg gaaattgaaa aagtcttatc
    2701  ctcagtagct gaaacagcaa tcagttcata tagaccacca gatgctgaaa
    2751  tgggtgaaga agcacccgca tatgcaccag ctacaagtgc aacaggatgg
    2801  gctggatcaa ggcctttccc ctttatgccc aaaggaggac caaggaggtg
    2851  ggattccaac aatgaatttt attcattacc tccagcacaa agtcggcaag
    2901  gagccatgtt cgtcatgcca atggactttg acatcaaagt attcgaaagg
    2951  tgggagagca ttaccctcct acacatgacg gaaaagattt ttgataatgc
    3001  tgacgacaaa atgagataca tggagaacct tctcggagaa gacgagaaga
    3051  agcacttcat tgaatggagg atgaagtata cagcagaata tgagacaatg
    3101  aaagctcaag cactcggaga ccaaggtaca caaaatatca tcaatcaaat
    3151  tcgattgata ttctttttgg aaaatccgca agtaggaact actacttcac
    3201  aagatgcggc ctataaaacc ttgaagagcc tggtctgcac agagatgaca
    3251  gacacagcaa tctacagata catgaatgat tatttccatc tgtcagccaa
    3301  aacaggaaga gcatgggcct cagaagaatt atccaaggaa ttctttacca
    3351  aactaccaag aggtctagga gatgaggttg aaaaggcatt catggaaaaa
    3401  cacccaagta acacagtagg gatcaccgca aggatcacct ttaccaaaag
    3451  atacctaaag gaactgtgtg aaaaggtagc actacaaaaa agtattggca
    3501  aaatggattt ctgcagaagc acgccagtac atggtttata cagagacaag
    3551  tcatacagaa agtatggagc tagaaaaagt acatcctaca agggaaagcc
    3601  ccataaatcc catgttagga ttggtaagaa gaaatattta tccttgagaa
    3651  agaaaaattg caggtgttat gcctgtggag aagagggaca tttcgcctct
    3701  gaatgcaaga atccaagaaa gatcatggat agagtcaagg ttctggactc
    3751  tctagacttg gaagatggat tagacgttat ctcagtcggc tttgatgaag
    3801  atgacgtatc agacatctat tcaatagatg aagaagctga taactacagg
    3851  ttcacaaatg aagaaatgga aggcttcaag aactacgagg tctatatgtt
    3901  aagaatggaa gagatggatg agccaaggga atatctcgta ggagaaccat
    3951  ctgaatggag atctaagatg aaagtctcca gaagacagta tttctgcaag
    4001  catgagtgga aatttgaaga gactcatgtg actatctgca aggcatgcgg
    4051  atctgaagca gctcctaagc ataggattga ctgcttgaaa tgtgagatga
    4101  ctgtttgtct catgtgccaa ccctggttct ataaaaacgt caacactgaa
    4151  gaagttaaga aaaccagagt tcggatagaa agggtaattg attggaagga
    4201  tattgcacta aaacaacacg aagttctcaa gaccagcatt gcaaatgaga
    4251  aacaactctc agaggaagta gaaatcttga ggaaacaaag caaagagctg
    4301  aaggaaaaag aaccaatcat ctttgaagaa gacacggagg aaacagctca
    4351  actgatacag aagctagaag acgtggaaag agaaaatgag cttctaaata
    4401  tccttatcaa gcagaaggaa aaggatgaaa tccaatacct caatgagatt
    4451  atagagctca aggaaagaat aaaagattta gagcagcaac agaaggacaa
    4501  ggaagaacaa gtaaatgtcc ttgaagaagt ctcgattaac gctctgaggc
    4551  caaggaacaa ccatctcaat atcaaatgtg agatagaagt caaaaacaag
    4601  aaggtagtcc tgaacgcaat tcttgacact ggagctacag tctgtgtagc
    4651  agatgagagg atgatacctt caggaatgaa agagcaggcc aaaaacaaaa
    4701  tcattattcg aggagtcaac ggagtcactg aagtaaacga ggtgacatca
    4751  gcgggaaagc tatgggttgg taagcaatgg ttctacctcc ctcaaacttt
    4801  tattatgcct tcattagctg atggagttca tatgatcata ggcatgaatt
    4851  ttattagaac tgttggccta aggatagaaa atggtgaggt cacaatttat
    4901  aagatcatga caacagtaca agccccacca atagttcatg agctgaatta
    4951  tattgatgaa ctagaactgg aacttcatga atactataac atatgtgcag
    5001  ctgagagttc tagaggggaa atttctgaag aatttatatc tcctgacatt
    5051  attggaaaaa tgaaaaaatt gggatatatt ggagaagaac ctctcaaaca
    5101  ttgggagaaa aatcaggtga aatgtaggat tgaagtaaaa aaccctgata
    5151  tgattattga agacaggcca ttaaaacatg ttacccctac aatgaaagaa
    5201  accatggcta agcatgtcca gaagctttta gaacttaaag tgatcaggcc
    5251  ttcaagctca aaacatagaa caacggcaat gatagtagaa tctgggacag
    5301  aggttgaccc aatgactgga aaggaaagaa gaggaaagga gagattggtg
    5351  tttaactata agaggctgaa tgataacact gaaaaagacc agtacagttt
    5401  gcctggaatt aacaccatta ttaagagaat tggaaatgcc aagatctata
    5451  gcaagtttga tttaaagagt gggtttcatc aagtagcaat ggacccagag
    5501  tctattccct ggacggcatt ttgggctata gatgggctgt atgagtggct
    5551  agttatgccc tttggactta aaaatgctcc tgccatattt caacgaaaaa
    5601  tggacaattg ctttagaggg acagaggatt ttattgcggt atacattgat
    5651  gacatactag tattctctga aacaatacac caacataaag agcatttgaa
    5701  gaaatttatg acaatctgcg agaaaaatgg tttagtctta agtccgacaa
    5751  aaatgaaaat tggaacaaga cagattgact tcctaggtgc aactattgga
    5801  aactcaaaaa ttaagttgca gcctcatatt attaaaaaga tcatcgaaat
    5851  gaaagatgaa gaactaaagg aagtgaaagg attaaggaaa tggctgggaa
    5901  tccttaatta tgctaggagc tacattccga aactgggaaa aatccttgga
    5951  ccactgtatg ccaaaacgag tcctaatgga gaaagaagaa tgaatactca
    6001  ggactggaaa attgtcaaag aggtcaagga agttgtagct aatctgccag
    6051  aacttgagtt accccccgaa aaagctatca tgataattga aacggatggc
    6101  tgtatggaag gctggggagg ggtatgtaag tggaaaactg atagtctgca
    6151  gccaagatgg tcagaaaaga tctgtgctta tgcgagcggg aaattcactc
    6201  ccatcaaaag cacaattgac gcagagatac aggctgtaat aaacagttta
    6251  gacaagttca agatatatta tcttgataag aaagagctca taatcagaac
    6301  tgacagtcaa gcaatagtga gcttttacaa gaaaagcagt gatcataaac
    6351  catcaagagt cagatggctt gccttcacag attacattac cgggacaggt
    6401  cttgagatta agtttgaaca cattgacgga aaggacaacg ttttagcaga
    6451  cactctgtca agactggtaa agattattct ccatccggaa aagcatcaat
    6501  ctgaaggtgt gttgatcaat gcagtggagg aggtatttca caagggaaac
    6551  accgatgcaa aacagagagt taatgatgtt gtaaaaagat atgaagactg
    6601  gttgagcaaa ggctacaggt tgcatcaaat caatgtgcta acactaagtg
    6651  aagagccggt tttcaaatgt ggatgcaata aaccagcaaa actgaagatc
    6701  tccagaacat ccagaaatcc tgacagggag ttttactcct gtgaaactaa
    6751  cacttgtttt acttgggtct ggaaagacca aattgactcg tttgtgcagg
    6801  aaaagatcag atgggagaag aaacttgaag aaatatcaga agactcactg
    6851  tgggaggaat tactgaggga gcaagaaaat ctgcgtgcag aacaagaata
    6901  tcttattgaa gatgctctag atctgctgga tatcagtaat gatgactgaa
    6951  gcggaagtgg cggaccccta ccacgtgttg ataccaaccg gtgtgaagac
    7001  tgataagatg cggagtgagc tggataccac tcactttatg taaagaggag
    7051  acaaagtata atgtctcttt attttaagtt tgtcggtgtg cgttgtctag
    7101  tcacgcacga tgacctttag taactttgca ggattcttac gcaaagttgt
    7151  taggccagag acatgtgatg atgcttatct gcattattgg tggatgccac
    7201  ctaacgatgc cagaaagctc cacaactctc tatataagga gccttgtatt
    7251  caggttgcaa acacgcacca caacgcgagt ttactcctga tttgagaaat
    7301  aaaaacttct gtgcttgaaa cacactttgt gcgagttcac tttgtgcgag
    7351  tagagcgcaa gatcctagtt ccgcgagcgt agacccgtc