!!NA_SEQUENCE 1.0
ID   BBE132844  standard; RNA; VRL; 3601 BP.
XX
AC   AJ132844;
XX
SV   AJ132844.2
XX
DT   12-DEC-1999 (Rel. 62, Created)
DT   13-DEC-2002 (Rel. 74, Last updated, Version 4)
XX
DE   Broad bean wilt virus 2 genes encoding 119kDa protein, 104kDa protein,
DE   large coat protein, small coat protein.
XX
KW   104kDa protein; 119kDa protein; large coat protein; small coat protein.
XX
OS   Broad bean wilt virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Comoviridae;
OC   Fabavirus.
XX
RN   [1]
RA   Qi Y., Zhou X., Xue C., Li D.;
RT   "Nucleotide sequence of RNA2 and polyprotein processing sites of a Chinese
RT   isolate of broad bean wilt virus 2";
RL   Prog. Nat. Sci. 10:680-686(2000).
XX
RN   [2]
RC   Revised by [3]
RA   Zhou X.;
RT   ;
RL   Submitted (06-FEB-1999) to the EMBL/GenBank/DDBJ databases.
RL   Zhou X., Zhejiang University, Huajiachi, Institute of Biotechnology 268
RL   Kaixuan Road, Hangzhou, Zhejiang 310029, CHINA.
XX
RN   [3]
RP   1-3601
RA   Zhou X.;
RT   ;
RL   Submitted (04-SEP-2000) to the EMBL/GenBank/DDBJ databases.
RL   Zhou X., Zhejiang University, Huajiachi, Institute of Biotechnology 268
RL   Kaixuan Road, Hangzhou, Zhejiang 310029, CHINA.
XX
DR   SPTREMBL; Q9Q2Q2; Q9Q2Q2.
DR   SPTREMBL; Q9Q2Q3; Q9Q2Q3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3601
FT                   /db_xref="taxon:76875"
FT                   /proviral
FT                   /organism="Broad bean wilt virus 2"
FT                   /strain="Chinese"
FT   CDS             231. .3428
FT                   /db_xref="SPTREMBL:Q9Q2Q3"
FT                   /product="119kDa protein"
FT                   /protein_id="CAB63085.1"
FT                   /translation="MRPELVAVLDRYFSEIISCFFLGWLLNFLLVWFCSTKSTFLLWSV
FT                   FLYICYYILRIEFAYIVAPFLKTIYTNSSQYHTVDWAYAYTALPKGLWEQITDYNYCYN
FT                   FPPPRVEGFVSDFSPRFTLKELEIMNEANITPVHTIPKDTLLKRASDYKLAVESKKSIL
FT                   PRVQDLYEMDKWHNLRSKLSKNAPSYVTTSEIAVGAMSGAGNTKLAIPVVEKYTEEVAD
FT                   DRLPDRVRAKADQIMVAAIELVADGFASVNSDVTMAGALYDKRHKTIASSFKGAFASRA
FT                   SGVPSHVIYFPMHRVPACDDPNTTLELSMVSRDSDFDEGYTLANISARTLYVRAKGPEK
FT                   VTETRHLLKAKTEDVVKARQFASEAQVVFATPRLFPEVNLDNYNLPGPSNAQQTEAITT
FT                   DRGILFPKPKFKGNEVVLNYTGSGKIRNVGSQRFETKKNATGEQFVRSVDDLGCLSDED
FT                   GKDYRYGQGLMEEDVLNVQTNNFAIESATETMRLLFSGYASIPLNVIPGTKITVAYLNE
FT                   LSKHSAVHTGLLNMLSKIPGSLKVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLL
FT                   GIQHYKWNPAIEPYVEFVFKPFSCADWWNMHYLGSFKFAPVVVIQTLSKWLNAPKVDAR
FT                   ISFAIYYEPTVVLPKQIATLEHAPAFMFRKEVGTLAFKQGERVAYSFEVNLGKPQTDGK
FT                   EVTSTFASSYCGLSQYMQSDVILDFTLMSSPMIGGTFSIAYVAGAYIEKVGNMQILDSL
FT                   PHIDFTFSSGSKSTRSVRFPKEVFGVYQALDRWDLDSARGDDVSGNFVLYQRDAVSSAL
FT                   EGELTFRIAARLSGDISFTGVSAGYPTTITRIGKGKTIGRSLDPEIRKPLRYMLGQAHA
FT                   TPKDFSSVRFVMGHWKYRAGLYPGSKSDEDIHPFSLKMRLDGSKSSENFEIIHSPFVRL
FT                   LQNCAWMRGTLRFYVVARASSDYMSYRRTSQLTVSAHENSLSSNQFYSGVLTSPSGELS
FT                   FSREVVGPVDGFASMGWNVRGSKKFYKIHVEMGNVHEYDTVVLYGQFDSNVEFAGQRKG
FT                   GHYLLEKETPIFKTIKY"
FT   CDS             615. .3428
FT                   /db_xref="SPTREMBL:Q9Q2Q2"
FT                   /product="104kDa protein"
FT                   /protein_id="CAB63086.1"
FT                   /translation="MNEANITPVHTIPKDTLLKRASDYKLAVESKKSILPRVQDLYEMD
FT                   KWHNLRSKLSKNAPSYVTTSEIAVGAMSGAGNTKLAIPVVEKYTEEVADDRLPDRVRAK
FT                   ADQIMVAAIELVADGFASVNSDVTMAGALYDKRHKTIASSFKGAFASRASGVPSHVIYF
FT                   PMHRVPACDDPNTTLELSMVSRDSDFDEGYTLANISARTLYVRAKGPEKVTETRHLLKA
FT                   KTEDVVKARQFASEAQVVFATPRLFPEVNLDNYNLPGPSNAQQTEAITTDRGILFPKPK
FT                   FKGNEVVLNYTGSGKIRNVGSQRFETKKNATGEQFVRSVDDLGCLSDEDGKDYRYGQGL
FT                   MEEDVLNVQTNNFAIESATETMRLLFSGYASIPLNVIPGTKITVAYLNELSKHSAVHTG
FT                   LLNMLSKIPGSLKVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLGIQHYKWNPA
FT                   IEPYVEFVFKPFSCADWWNMHYLGSFKFAPVVVIQTLSKWLNAPKVDARISFAIYYEPT
FT                   VVLPKQIATLEHAPAFMFRKEVGTLAFKQGERVAYSFEVNLGKPQTDGKEVTSTFASSY
FT                   CGLSQYMQSDVILDFTLMSSPMIGGTFSIAYVAGAYIEKVGNMQILDSLPHIDFTFSSG
FT                   SKSTRSVRFPKEVFGVYQALDRWDLDSARGDDVSGNFVLYQRDAVSSALEGELTFRIAA
FT                   RLSGDISFTGVSAGYPTTITRIGKGKTIGRSLDPEIRKPLRYMLGQAHATPKDFSSVRF
FT                   VMGHWKYRAGLYPGSKSDEDIHPFSLKMRLDGSKSSENFEIIHSPFVRLLQNCAWMRGT
FT                   LRFYVVARASSDYMSYRRTSQLTVSAHENSLSSNQFYSGVLTSPSGELSFSREVVGPVD
FT                   GFASMGWNVRGSKKFYKIHVEMGNVHEYDTVVLYGQFDSNVEFAGQRKGGHYLLEKETP
FT                   IFKTIKY"
FT   mat_peptide     1629. .2834
FT                   /product="large coat protein"
FT   mat_peptide     2835. .3425
FT                   /product="small coat protein"
XX
SQ   Sequence 3601 BP; 1030 A; 664 C; 843 G; 1064 T; 0 other;

AJ132844  Length: 3601  February 13, 2003 15:26  Type: N  Check: 3924  ..
       1  tgttttaata aaatattaaa acaaacagct ttcgtttcga gaaaacagct
      51  ttcagtcact aaacagcttt cagttacaaa acagctttcg gatactttga
     101  agttttcaat ttgaacccgg aaaaagggag tgtgatttaa agcgaaccat
     151  atattttgaa acttcttcac tttattttcc ttcatttgca agtgcattct
     201  acattcaaaa cttgttttga acatgttgta atgcgtcccg agcttgtagc
     251  agtgttagat agatactttt cagaaattat aagttgtttc tttctgggtt
     301  ggttactaaa ttttctgctt gtttggttct gttctacaaa aagcactttt
     351  cttttgtggt cagtgttttt gtatatttgt tactatatat tgaggattga
     401  atttgcatat atcgttgcac ccttcttaaa aacgatatac acaaatagtt
     451  ctcagtatca tactgtagac tgggcatacg catacacagc attgcctaaa
     501  gggttgtggg agcaaatcac tgattacaat tactgttaca attttcctcc
     551  tcctcgcgtc gaaggttttg tgtccgattt ttcaccaaga ttcacactta
     601  aagaacttga aatcatgaat gaggcaaata tcactccagt gcatacaatc
     651  ccaaaagaca cgttacttaa gagagcaagt gattataagt tggctgtgga
     701  gagcaagaaa tccatcttac caagagtgca agatttgtat gagatggata
     751  aatggcacaa cttgagaagc aaattgagca aaaatgcccc tagctacgta
     801  acgacgtcag agattgctgt cggtgcgatg tcaggtgcgg gaaacactaa
     851  attggcgata ccagttgtgg aaaagtacac tgaggaagtg gcagacgata
     901  gattgccaga tagagtgcgc gctaaagctg atcagataat ggttgcagct
     951  attgagttgg ttgcggatgg tttcgcctcg gtcaattcgg acgtcaccat
    1001  ggctggtgca ctttatgaca agcgccacaa gaccattgca agttccttca
    1051  aaggagcttt tgcatctcgg gcaagtggag tcccttcaca tgtaatttac
    1101  tttccaatgc atagagttcc agcatgtgat gacccaaaca caacgttgga
    1151  gctttcaatg gtaagtcgag attcagactt tgatgagggc tatacactgg
    1201  ccaacatatc agcccgcact ctttacgttc gtgcaaaagg acctgaaaag
    1251  gtgactgaaa caaggcatct tttgaaggcc aaaactgagg atgtggtcaa
    1301  agcgcgccag tttgctagtg aagcacaggt cgttttcgct acgccccgat
    1351  tattccctga agtgaatttg gacaattaca atttgcctgg gcctagcaat
    1401  gcacaacaga cagaggctat caccaccgac agaggaatat tgtttccaaa
    1451  accgaaattc aaaggtaacg aagttgtgct caattacaca ggttcaggga
    1501  aaatcaggaa tgttggctct cagagatttg agacaaagaa aaacgccact
    1551  ggtgaacagt ttgtcagaag cgttgacgac cttggatgtt tgtctgatga
    1601  ggatggcaaa gattataggt atggccaggg tttgatggag gaagatgttc
    1651  tgaatgtgca aacaaacaat tttgccattg agtctgctac agagactatg
    1701  cgcctattat ttagtggata tgcaagcatt ccattaaatg taatacctgg
    1751  aacaaaaatc actgtggctt acttgaatga attgtctaaa catagcgctg
    1801  tgcatactgg cttgttaaac atgttgagta agattcctgg ttctttgaaa
    1851  gtcaaaatta attgtcaggt ggcaccgaca tgtggtattg gactggcagt
    1901  cagctatgtc gaaggaaatg aaagtgcaaa cctgggttct agtctgggac
    1951  gtttgttagg cattcagcac tacaaatgga atccagcaat agagccatat
    2001  gtggagtttg ttttcaaacc tttctcttgt gcagattggt ggaacatgca
    2051  ctatctggga tcttttaagt ttgcccctgt ggtcgtgata caaacgcttt
    2101  ccaaatggct gaatgctccg aaggtggatg ccagaataag ctttgcaatc
    2151  tattatgagc ccaccgttgt gttgcctaag caaatagcaa ctctggaaca
    2201  tgccccggca ttcatgtttc gcaaagaggt ggggacatta gctttcaaac
    2251  aaggggagcg tgtggcttat tcttttgaag ttaatttggg aaaaccgcag
    2301  acagatggga aagaagttac ttcaactttt gcctcttcgt actgcggact
    2351  tagtcaatat atgcaatcgg atgtcattct agattttact cttatgagta
    2401  gccccatgat aggtggaact ttctcaattg catatgttgc tggagcttac
    2451  attgaaaagg ttgggaatat gcaaattctc gactcactgc cccacatcga
    2501  ttttaccttc tcctctgggt ctaaaagtac gcgatctgtg cgctttccta
    2551  aggaagtctt tggagtgtac caagcgcttg atagatggga tttggattcg
    2601  gcaagagggg atgatgtctc aggcaacttc gtgctttatc aaagagatgc
    2651  agtctcaagc gccttggaag gagagctcac attcagaata gcagctcgtt
    2701  tgtctggaga catcagtttc acaggtgtaa gtgcaggcta cccaacaacg
    2751  atcacgcgca tagggaaggg caaaactata gggagatcac ttgatcctga
    2801  aatcagaaag cctttgagat atatgcttgg gcaagcgcat gcgacaccca
    2851  aagattttag ttcagtgcgc ttcgtgatgg gccattggaa atacagagca
    2901  ggcttgtatc ctgggagcaa atcagatgag gacattcatc ccttttcttt
    2951  aaagatgcgt ttggatggat ccaagagcag tgagaatttt gaaattatac
    3001  attctccttt tgtgcgcttg ttgcagaatt gcgcatggat gagaggaact
    3051  ctgaggttct acgtggtagc tcgtgctagt tctgactata tgagctaccg
    3101  cagaacatct caattaacgg tttcagctca tgaaaatagt cttagttcca
    3151  atcagttcta tagtggagtt ttaacgagtc caagtggtga gttgagtttc
    3201  tccagagagg tggttggtcc tgtggatggt tttgcatcta tgggttggaa
    3251  cgtgcgtggg agtaagaagt tttataagat acacgtggag atggggaatg
    3301  ttcatgagta tgatacagta gtgttgtacg gacaatttga ctctaatgtc
    3351  gaatttgctg gccaacgaaa aggtgggcat tacctattgg aaaaggaaac
    3401  tcccatattt aagacaatta agtattaata attcaagtag ttgtttggcg
    3451  tttgaatttt aataaaaagg cgtaggtcac tagcctccca ttaaaatggg
    3501  ttccatgacc tttgtttgat tgtaaaattt actatttcta aaacacatgt
    3551  gtgctgtgtt aggttgaagc ttcctatatg tataggcttc aatagtattt
    3601  t