!!NA_SEQUENCE 1.0
ID   BNE236894  standard; RNA; VRL; 1338 BP.
XX
AC   AJ236894;
XX
SV   AJ236894.1
XX
DT   09-FEB-1999 (Rel. 58, Created)
DT   24-NOV-1999 (Rel. 61, Last updated, Version 2)
XX
DE   Beet necrotic yellow vein virus C RNA encoding 26kDa protein, clone pGBW527
XX
KW   26kDa protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RA   Li D.W., Yu J.L., Han C.G., Liu T., Qin S.C., Liu Y., Koenig R.;
RT   "Detection and nucletide sequence analysis of beet necrotic yellow vein
RT   virus RNA5 isolated from China";
RL   Chin. J. Biotechnol. 15:461-465(1999).
XX
RN   [2]
RP   1-1338
RA   Li D.;
RT   ;
RL   Submitted (08-FEB-1999) to the EMBL/GenBank/DDBJ databases.
RL   Li D., China Agricultural University, National Laboratory of
RL   Agrobiotechnology, No. 2 Yuanmingyuan west Road, Beijing, 100094, PROC
XX
DR   SPTREMBL; Q9YPK4; Q9YPK4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1338
FT                   /db_xref="taxon:31721"
FT                   /note="RNA5"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /strain="C"
FT                   /isolate="Baotou"
FT                   /clone="pGBW527"
FT   5'UTR           1. .439
FT   CDS             440. .1126
FT                   /db_xref="SPTREMBL:Q9YPK4"
FT                   /product="26kDa protein"
FT                   /protein_id="CAA15424.1"
FT                   /translation="MDIDHCMPAFDMAYSDDNHLPYYIQRSIHHVVRDVDYTGFICYPL
FT                   QVDLNDDVEVGVDIYHMKIKTMRLNVDIYNNDVATNFPGWVRFIVFCTPPVSSWVNDGC
FT                   SSLFSPFVGVNSFIDPKLLKRDGHGITVLHDGIYCLCHREHFTGSFEFNFRGPGNYTLT
FT                   NDVCWSPATNVDSIYVACVATWCGDSAFMLQSDSVSWVHKRFWQRPVLELGQCLDDLPD
FT                   HDNNCG"
FT   3'UTR           1127. .1338
XX
SQ   Sequence 1338 BP; 346 A; 223 C; 299 G; 470 T; 0 other;

AJ236894  Length: 1338  December 21, 2001 15:37  Type: N  Check: 5787  ..
       1  aaattcaaag tactttcaca ttgtacttat tagtaccgct gttctaagtg
      51  acgtaagtgg ggtgtaggcc cggggagctg gatgcagtaa tttatcgatg
     101  taccttttcg actacctcaa tttgaaaacg agtgtaaagt aaaagggagg
     151  ttactaaaca aaatagccct ccatacggta cgatttataa tcatatttat
     201  atgcccactt ggtgtcactc agaagcagtg tttgtgaaaa tttgtgcgtg
     251  agccttgtgc cgcacttgcg tgagcctttg gccgcttttc ctttgcgatt
     301  gtactttgtt tttccgctcg cacaagcgtt aaagtactag ttacggtgca
     351  taaaatataa aaataaaata aaataacttg aattattaac agcaattcgc
     401  atttgcaagt tgcgatcata atcatattta caatttgtga tggatattga
     451  tcattgtatg cctgcatttg atatggcata tagcgacgat aatcacctcc
     501  cttattacat acagagatcg attcatcacg tggttcggga tgttgattat
     551  actggtttta tatgttatcc tttgcaggtc gatcttaatg atgatgttga
     601  ggtcggtgtt gatatttatc acatgaagat taagactatg agacttaatg
     651  ttgatattta taataatgat gttgccacaa attttccagg ttgggtcagg
     701  tttattgtgt tttgtacacc tcctgtgtct tcttgggtca atgacgggtg
     751  ctctagtctg ttttcacctt ttgtaggtgt gaatagtttt attgacccca
     801  aactgttaaa acgtgatggt catgggatta ctgtgttaca tgatggtatt
     851  tattgtctgt gccatcgcga acattttacc ggaagtttcg agtttaactt
     901  tcgtggacct ggtaattata ccctaactaa tgatgtttgt tggtcccctg
     951  ctactaatgt agattctata tatgtggctt gtgttgctac ttggtgtggc
    1001  gatagtgctt ttatgttgca gtccgatagt gtgtcttggg tacacaagag
    1051  attttggcaa cgacctgtgt tggaacttgg gcaatgttta gatgatctac
    1101  cagatcatga taataattgt ggatgatcgt ttgtgacgtc cgaagacgtt
    1151  aaactacccg catgcgcggt gtttacgggc tcgtttacaa gcctccttgc
    1201  tatggtaagg tttatgtaaa cacaaaaata tggcttattg gttatgctaa
    1251  acctcatatg ttattaaata aggttgagat gtactgactg gatgtgaaat
    1301  gtgccagtct tcatagggtt ctctgtcagt gtattgac