!!NA_SEQUENCE 1.0
ID   BNE236895  standard; RNA; VRL; 1358 BP.
XX
AC   AJ236895;
XX
SV   AJ236895.1
XX
DT   09-FEB-1999 (Rel. 58, Created)
DT   24-NOV-1999 (Rel. 61, Last updated, Version 2)
XX
DE   Beet necrotic yellow vein virus C RNA encoding 26kDa protein, clone pGBW710
XX
KW   26kDa protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RA   Li D., Yu J., Han C., Liu T., Qin S., Liu Y.;
RT   "Detection and nucletide sequence analysis of beet necrotic yellow vein
RT   virus RNA5 isolated from China";
RL   Unpublished.
XX
RN   [2]
RP   1-1358
RA   Li D.;
RT   ;
RL   Submitted (08-FEB-1999) to the EMBL/GenBank/DDBJ databases.
RL   Li D., China Agricultural University, National Laboratory of
RL   Agrobiotechnology, No. 2 Yuanmingyuan west Road, Beijing, 100094, PROC
XX
RN   [3]
RA   Li D.W., Yu J.L., Han C.G., Liu T., Qin S.C., Liu Y., Koenig R.;
RT   "Detection and nucletide sequence analysis of beet necrotic yellow vein
RT   virus RNA5 isolated from China";
RL   Chin. J. Biotechnol. 15:461-465(1999).
XX
DR   SPTREMBL; Q9YPK3; Q9YPK3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1358
FT                   /db_xref="taxon:31721"
FT                   /note="RNA5"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /strain="C"
FT                   /isolate="Huhhot"
FT                   /clone="pGBW710"
FT   5'UTR           1. .459
FT   CDS             460. .1146
FT                   /db_xref="SPTREMBL:Q9YPK3"
FT                   /product="26kDa protein"
FT                   /protein_id="CAA15425.1"
FT                   /translation="MDIDHCMPVFDMAYSDDNHLPYYIQRSTHHVVRDDDYTGFICYPL
FT                   QVDLNDNVEVGADIYHMKIKTKRFNVDIYNNDVATKFPGWVRFIVFCTPPVSSWVNDGC
FT                   SSLFSPFVGVNSFIDPKLLKRDGHGITVLHDGIYCLCYQEHFTRSFEFNFRGPGNYTLT
FT                   NDVCWSPATNVDSIYVACVASWCGDSAFMLQSDSVSWVLKRFWQRPVLEFGQCLDDLPD
FT                   HDNDCG"
FT   3'UTR           1147. .1358
XX
SQ   Sequence 1358 BP; 369 A; 208 C; 298 G; 483 T; 0 other;

AJ236895  Length: 1358  December 21, 2001 15:37  Type: N  Check: 8128  ..
       1  aaattcaaag tactttcaca ttgtacttat tagtaccgct gtcctaagtg
      51  acgtaagtgg ggtgtaggcc cggggagctg gatgcagtaa tttatcgatg
     101  taccttttcg actacctcaa tttgaaaacg agtgtaaagt aaaagggagg
     151  ttactaaaca aaatagccct ccatacggta cgatttataa tcatatttat
     201  atgcccactt ggtgtcactc agaagcagtg tttgtgaaaa tttgtgcgtg
     251  agccttgtgc cgcacttgcg tgagcctttg gccgcttttc ctttgcgatt
     301  gtactttgtt tttccgctcg cacaagcgtt aaagtactag ttacagtgca
     351  aaaataaaat aaaaataaaa ataaaaataa aataaataac ttaaattatt
     401  aatagtaatt tgcaatttgt aagttacgac tataattata attataatta
     451  caatttgtga tggatattga tcattgtatg cctgtatttg atatggcata
     501  tagcgacgat aatcacctcc cttattacat acagagatcg actcatcatg
     551  tggttcggga tgatgattat actggtttta tatgttatcc tttgcaggtt
     601  gatcttaatg ataatgttga ggttggtgct gatatttatc acatgaagat
     651  taagactaag agatttaatg ttgatattta taacaacgat gttgccacaa
     701  agttcccagg ttgggttagg tttattgtgt tttgtacacc tcctgtgtct
     751  tcttgggtta atgacgggtg ctctagtctg ttttcacctt ttgtaggtgt
     801  gaatagtttt attgatccta aattgttaaa acgtgatggt catgggatta
     851  ctgtgttaca tgatggtatt tattgcttgt gctatcaaga acattttacc
     901  agaagttttg agtttaactt tcgtggacct ggtaattata ccctaactaa
     951  tgatgtttgt tggtcccccg ctactaatgt agattctata tatgtggctt
    1001  gtgttgctag ttggtgtggt gatagtgctt tcatgttgca gtccgatagt
    1051  gtgtcttggg tactcaagag attttggcaa cgacctgtgt tggaatttgg
    1101  gcaatgtttg gatgatctac cagatcatga taatgattgt ggatgatcgt
    1151  ttgtgacgtc cgaagacgtt aaactacccg cgtatgcggt gtttacgggc
    1201  tcgtttacaa gcctcctagc tatggtaagg tttatgtaaa cacaaaaata
    1251  tggcttattg gttatgctaa acctcatatg ttattaaata aggttgggat
    1301  gtactgactg gatgtgaaat gtgccagtct ttatagggtt ctctgtcagt
    1351  gtattgac