!!NA_SEQUENCE 1.0
ID   BNY239199  standard; RNA; VRL; 1465 BP.
XX
AC   AJ239199;
XX
SV   AJ239199.1
XX
DT   11-FEB-1999 (Rel. 58, Created)
DT   11-FEB-1999 (Rel. 58, Last updated, Version 1)
XX
DE   Beet necrotic yellow vein virus (strain C) mRNA for 31 kDa protein
XX
KW   31 kDa protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1465
RA   Yu J., Han C., Yang L., Li D., Liu Y.;
RT   "cDNA cloning, sequencing and expression of RNA4 from beet necrotic yellow
RT   vein virus";
RL   Acta Microbiol. Sin. 37:7-14(1997).
XX
RN   [2]
RP   1-1465
RA   Li D.;
RT   ;
RL   Submitted (09-FEB-1999) to the EMBL/GenBank/DDBJ databases.
RL   Li D., China Agricultural University, National Laboratory for
RL   Agrobiotechnlogy, No.2 Yuanmingyuan West Road, Beijing, China, 100094
XX
DR   SPTREMBL; Q65670; Q65670.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1465
FT                   /chromosome="RNA4"
FT                   /db_xref="taxon:31721"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /strain="C"
FT                   /clone="pGBF6"
FT                   /isolate="NM"
FT   5'UTR           1. .376
FT   CDS             377. .1225
FT                   /db_xref="SPTREMBL:Q65670"
FT                   /function="vector transmission"
FT                   /product="31 kDa protein"
FT                   /protein_id="CAA15427.1"
FT                   /translation="MADGEICRCQVTDPPLIRHEDYDCTARMVQKRIEIGPLGVLLNLN
FT                   MLFHMSRVRHIDVYPYLNNIMSISVSLDVPVSSGVGVGRVRVLIFTTSRERVGIFHGWQ
FT                   VVPGCFLNAPCYSGVDVLSDELCEANITNTSVSSVAMFNGSYRPEDVWILLLTSSTCYG
FT                   YHDVVVDIEQCTLPSNIDGCVCCSGVCYFNDNHCFCGRRDSNPFNPPCFQFIKDCNELY
FT                   GTNETKQFICDLVGDDNLDSVNTLTKEGWRRFCDVLWNTTYGDVESRTFARFLWFVFYH
FT                   D"
FT   3'UTR           1226. .1465
XX
SQ   Sequence 1465 BP; 362 A; 213 C; 332 G; 558 T; 0 other;

AJ239199  Length: 1465  December 21, 2001 15:37  Type: N  Check: 361  ..
       1  aaatcaaatc tcaaatatat atttgtattt ccagttgatt gtctgtaaaa
      51  caattccagt tgtttgtctg taaaacaaac atttatgctt gatcagcttt
     101  gtagatcctt gattaatctt atttctatca ttgaattcga attgtttctg
     151  ttgagattct ctttacgatt tgtgtcgcca tttcgtatat tggaagacgg
     201  gcctgattcc agtatttatt ggtcagttta taggtgcaga acgcttttaa
     251  gtgagaccta cgactgcgtc ggaaccttag attcacgagc cgcgtgatta
     301  attgggtttg tcactgggat ccagtctatc agtaaggggt agtccgttgt
     351  tgagacttat ctgattagta acatttatgg ctgatggaga gatatgtcgg
     401  tgtcaggtta ctgatcctcc tttgatacgt catgaagact atgattgtac
     451  tgctaggatg gtgcagaaac ggattgagat tggcccattg ggtgtcttac
     501  tcaatctaaa tatgttattt catatgtctc gtgttagaca tattgatgtt
     551  tatccgtatc tgaataatat tatgtctatt tcggtgtcgt tggatgttcc
     601  tgtgtctagt ggcgttggtg ttggacgtgt acgtgtttta atatttacaa
     651  ctagtcgtga acgtgttggt atattccatg gatggcaggt tgtgcctggg
     701  tgctttctta atgccccgtg ttatagtggt gttgatgttc tgtctgatga
     751  gttatgtgaa gctaatatca ctaatacttc ggtttcgtct gttgcgatgt
     801  tcaatgggtc gtatagacct gaagacgtct ggatactatt acttacgtct
     851  agtacttgtt atggttatca tgatgttgtt gttgatatag aacaatgtac
     901  attaccttct aatatagatg ggtgtgtttg ttgttctggc gtttgctatt
     951  tcaatgataa tcattgtttt tgtggtcgtc gtgatagtaa tccattcaat
    1001  ccgccttgtt ttcaatttat taaagattgt aatgagttgt atggaacaaa
    1051  tgaaactaaa caattcattt gtgaccttgt tggtgatgat aacttggata
    1101  gtgttaacac tctaacaaag gaagggtggc gaaggttttg tgatgttctt
    1151  tggaatacca cttatggtga tgttgagtct cgtacttttg cacggtttct
    1201  gtggtttgtc ttttatcacg attagtggta ttgatgatgt gtttagttat
    1251  tcgagataca agactaataa tatgtataat tgtattatca acgggctcgt
    1301  tcacaagcct ccttgctatg gtaaggttta tgtgaacaca aaaatatggc
    1351  ttattggtta tgctaaacct catatcgtat taaatatata taagttaagg
    1401  ttgagatgta ctgactgggt gtgaaatgta ccagtcttta tagggttctc
    1451  tgtcagtata ttgac