!!NA_SEQUENCE 1.0
ID   BNY239200  standard; RNA; VRL; 1775 BP.
XX
AC   AJ239200;
XX
SV   AJ239200.1
XX
DT   11-FEB-1999 (Rel. 58, Created)
DT   11-FEB-1999 (Rel. 58, Last updated, Version 1)
XX
DE   Beet necrotic yellow vein virus (strain C) mRNA for 25 kDa protein
XX
KW   25 kDa protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1775
RA   Li D., Yu J., Han C., Xing Y., Liu Y., Chen S.;
RT   "Sequence analysis of RNA3 from beet necrotic yellow vein virus NM isolate
RT   and expression of 25 kDa protrin gene in E.coli";
RL   Ping Tu Hsueh Pao 14:165-171(1998).
XX
RN   [2]
RP   1-1775
RA   Li D.;
RT   ;
RL   Submitted (09-FEB-1999) to the EMBL/GenBank/DDBJ databases.
RL   Li D., China Agricultural University, National Laboratory for
RL   Agrobiotechnlogy, No.2 Yuanmingyuan West Road, Beijing, China, 100094
XX
DR   SPTREMBL; Q9YPK2; Q9YPK2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1775
FT                   /chromosome="RNA3"
FT                   /db_xref="taxon:31721"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /strain="C"
FT                   /clone="pGBY56"
FT                   /isolate="NM"
FT   5'UTR           1. .445
FT   CDS             446. .1105
FT                   /db_xref="SPTREMBL:Q9YPK2"
FT                   /evidence=EXPERIMENTAL
FT                   /function="pathogenicity"
FT                   /product="25 kDa protein"
FT                   /protein_id="CAA15428.1"
FT                   /translation="MGDILGAVYDLGHRPYLARRTVYEDRLSLSTHGNICRAINLLTHD
FT                   NRTTLVYHNNTKRIRFRGLLCAYHGPYCGFRALCRVMLCSLPRLCNIPINGSHGFVEDP
FT                   TRLDSSDNELLVSNGLVIHYDRAHNDPIHTDGYEVVDFTTVLRGPGNFLLPNATNFPRS
FT                   TTTDQVYMVCLINTVNCVLRFESGLTVWVHSGLYTGDVLDVDNNVIQAPDGVDDDD"
FT   3'UTR           1395. .1775
XX
SQ   Sequence 1775 BP; 451 A; 316 C; 373 G; 635 T; 0 other;

AJ239200  Length: 1775  December 21, 2001 15:37  Type: N  Check: 5428  ..
       1  aaaattcaaa atttaccatt acatattggt atttatttac cctcagttgg
      51  tgatatatgt gaggacgcta gcctgttggg tttcctgacc gaccaaatcc
     101  aagcgagctt aatccaagta cctcgtctca aattgagtgt caagtgaata
     151  agcatagtga ccccatcgtt tcagggtagt tgacggctat taatagatat
     201  actacaaacg cttctcttta tttatcacca acatgggatg taatgtttat
     251  gcgtgagcta cggccgcatt gtaaaattag tggttttgaa tttctattct
     301  ccggaatata caaggtttaa aagaccagcc tttgggttaa aaatttttaa
     351  accttactat ctttcactag taactcgaac tcgatttata ttcagatttt
     401  gcacgtcgcg ttgttgtgtt ctctgatcat cattaagtgg ccgtcatggg
     451  tgatatatta ggcgcagttt atgatttagg gcacagacct tacctagcac
     501  ggcgtacggt ttatgaggat cgtttgagtc ttagcacaca tggtaatatc
     551  tgtcgggcta ttaacttgtt aactcacgat aatcgtacta cactggtgta
     601  tcacaataat actaaacgca taaggtttcg tggattattg tgtgcttatc
     651  atgggcctta ttgtgggttt cgtgccttat gtagagtaat gttatgttct
     701  ctacctcgtt tgtgtaacat ccctatcaat ggatctcacg gctttgttga
     751  agatcctacc agactcgaca gctctgataa tgagttgttg gtttctaatg
     801  gtctcgtcat ccactatgat cgtgctcata atgatcccat acacactgat
     851  ggttatgaag ttgtagactt tacgactgtc ttacgtggtc ctggaaattt
     901  tcttttgcct aatgcaacaa atttccctcg gtcaaccaca accgatcagg
     951  tttacatggt ctgtttgata aacacggtta attgtgtgtt acgttttgag
    1001  tccggactta cagtgtgggt tcactctggt ttgtatacag gtgatgtttt
    1051  agatgtggat aataatgtta ttcaagcccc tgacggtgtt gatgatgatg
    1101  attagagtta tcacaatttc aacaacacac ttattggtgt gttgttctgt
    1151  tacaccattt gaaagtttaa taattgtctc aattcgattg ttgatctggt
    1201  tgggacaatt attttatttt cttttggtgt aatcgtccga agacgttaaa
    1251  ctacacgtga tttcacggtg tttgatgaga agattgttta acggtgttac
    1301  gttgtgcact tttaagcctt cttctcattt taccacatgt gatgattgta
    1351  gcctgtgggt cgttatgtgg acaattatgg ttacttattt gtaaatgata
    1401  aagagtgtgc ggtagccgac tttatccgag tgggagtagt tgtgttatta
    1451  ctactattct ggtccgtata aagatccttg acggcggcat cgtgggttcc
    1501  acagccggtt acatgatgtt cccgtccgtt tacgaaggtt taactgtgag
    1551  ccttgtattt tacgaataca cagtttttat cttaacaggc tcgttcacaa
    1601  gcctcctttt acattaagtt taaaggttta tgtggacaca aaaatatggc
    1651  ttattggtta tgctaaacct catatcatgt tataatattc gtttcatatt
    1701  ataattaagg ttaagatgta ctgactgggt gtgaaatgta ccagtccttg
    1751  tagggttctt tgtcagtata ttgac