!!NA_SEQUENCE 1.0
ID   ACH243438  standard; RNA; VRL; 7545 BP.
XX
AC   AJ243438;
XX
SV   AJ243438.1
XX
DT   29-JUN-1999 (Rel. 60, Created)
DT   02-JUL-1999 (Rel. 60, Last updated, Version 2)
XX
DE   Apple chlorotic leaf spot virus complete genomic RNA
XX
KW   216K protein; coat protein; complete genome.
XX
OS   Apple chlorotic leaf spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Trichovirus.
XX
RN   [1]
RP   1-7545
RA   Jelkmann W.;
RT   ;
RL   Submitted (27-JUN-1999) to the EMBL/GenBank/DDBJ databases.
RL   Jelkmann W., Institute for Plant Protection in Fruit Crops, Fed. Biol. Res.
RL   Centre for Agriculture and Forestry, Schwabenheimer Str. 101, D-69221
RL   Dossenheim, GERMANY.
XX
RN   [2]
RA   Jelkmann W.;
RT   "The nucleotide sequence of a strain of apple chlorotic leafspot virus
RT   (ACLSV) responsible for plum pseudopox and its relation to an apple and
RT   plum bark split strain.";
RL   Phytopathology 86:101-101(1996).
XX
RN   [3]
RA   Jelkmann W.;
RT   "The nucleotide sequence and genomic organization of a stain of apple
RT   chlorotic leafspot virus (ACLSV) responsible for plum pseudopox";
RL   Unpublished.
XX
DR   SPTREMBL; Q9WSQ4; Q9WSQ4.
DR   SPTREMBL; Q9WSQ5; Q9WSQ5.
DR   SPTREMBL; Q9WSQ6; Q9WSQ6.
DR   SPTREMBL; Q9WSQ7; Q9WSQ7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7545
FT                   /country="Germany"
FT                   /db_xref="taxon:12175"
FT                   /virion
FT                   /organism="Apple chlorotic leaf spot virus"
FT                   /strain="plum pseudopox"
FT                   /isolate="PBM1"
FT   CDS             152. .5803
FT                   /db_xref="SPTREMBL:Q9WSQ7"
FT                   /note="ORF1"
FT                   /product="216 K polyprotein"
FT                   /protein_id="CAB46073.1"
FT                   /translation="MAFSYRTPQEELLSRLPQSQQEVISGFQYERIQKEEEKKVENLFF
FT                   YLPEKTREWFTKSGVYLSPFAYVNHSHPGCKTLENHLLFNVVASYISKYSYVACLSIKS
FT                   NKMSKMERLGSNSVKTYDILNRLVTVKGKGRYGPLAKPERSPCPKKTNIFIHDEIHYWS
FT                   RDQLETFLQVHRPKNLWATLVFPPEILAGYKSSVLPFLYQFEIHGKDLVYMPDGVRSES
FT                   YTQPLENGYLLSSSSILVRNKTTGVEMRYQVSLIYSLGSHHLFHIYPTEDLMKEEVRRF
FT                   GPYDLFDVGSLFVKPVRVPIQDFPLSVFKKIFIYISSLKRPGVQSAVAKLRQLSDADIS
FT                   IESVFMVQEFASRIEKDGVEKWSCSFWGCMKDWFFDKLPYREVLEKIGLADDFTRRLMK
FT                   IKPLAFDIHTTDRPLTDRMVIDQIWEERQSSCDDIPNIVFYGRKEWIEHGVVPKIKKSL
FT                   AKLIPGREMESSDYPKEIYSDLLSSTSIWRSYDDDLRHRNASPTVVLKSSRSYSEAAGF
FT                   NSHCLSICATAHDEVVMKTPFELKREANKKELSMHCLNFHMKKMKVKSLPELEAKLNEH
FT                   GKGIFRKKEGTRKVKRPRMVPVHLLKQVNDVKGDKINEETRRKPNPQPGKRRNEGEKDV
FT                   SPHDEGFPVECTKTNAQSAQKFPTSSKLSDLIGKTQLSSRGLIKTVGNDYLALAEQIEC
FT                   MPLSQLKNKKAAYFCLDFPMVYFHDRVSYPAFEATGEIRQVIMRARDKWGINFNSALIQ
FT                   VYNDGCRLPLHSDNEECYDDDGILTINVKGDAKFHTTCHDEVIELKQGNEILMPAGYQK
FT                   RNRHAVEVDSEGRTSVTLRVHKRDFSFESKLRFIKGKFDCLFVSIAEIIHKKPEEVMMF
FT                   IPHIMDRCVSNKGCSLDDAKAICERYEIKIECEGDCGLVECGTSGLSVGRMLLRGNHFT
FT                   VASVRRSSIDSLANSSKEIKSNGVLDHVTFNFHKRLKLVEPDLTMVDTKVDPSRAGKLL
FT                   KSLMDGMTGIVSHNSTHEGWRMIKGINSTSEMRSFMSMIKGQCEDTKSDLFDKVQELNF
FT                   MKVKIYGIFGFAGSGKSHAIQNLIQTEFKGSQGVMVICPRRFLAKDWSEKGVDEKDIKT
FT                   LESALKSDIKGKRLFILDEVSLLPKGFTDLIMLKMHMEEILKKSTIVCIGDPLQAGYFC
FT                   PKDDSYLSREGEIKRLFKDGVNYKWYSYRINKFVAKKLAIETMNDFIGIDEQSSIYKDM
FT                   PSANHFMEKKGNHIEVILVASMVEKELYSNYGNVMTFGESQGLTFNCGVIVLSEEAKLC
FT                   SDAHIMVAITRFRRGFCFALGSKGSKEDYMRSMKSGLLQRMCSGIGASKEFILGSSSVS
FT                   LNLSEKDITRGAGVDEMDREARLEGDVWLKSMIYLGKRYHMIEPLGQVIKLTDSAIKCH
FT                   IPVCSSQTLGPELDNIQAREFREFKGKNGWSNQFREEAGPNWRFPYKVNQAMSYEAVYP
FT                   RHRMDDDLTFLAAIKKRLRFDNVANNYAKFKAAENRGKYLAKIFLKHVPIKCGRDQRLL
FT                   DQCRQEFEETKLSKSAATIGAHSQRSDSDWPLDKIFLFMKSQLCTKFEKRFTEAKAGQT
FT                   LACFPHKILVEFSPWCRYTEKVLSANLPDNYYIHQRKNFSELEDFAKRFSNGSVCVESD
FT                   YTAFNVSQDHTILAFKVELLKHFGWDDSILQSYIKMKCTLGCRLGGFAIMRFTGEFSTF
FT                   LFNTLANMVFTFCRYEVPDGTPICFAGDDMCALRNLREIDTHEFILNKLSLKAKVNRTR
FT                   VPMFCGWRLCCDGLIKEPCLIYERLQVAIENGRLMDVIDSYFLEFSFAYKLGERLYSHL
FT                   EIEQLNYHQVLTRFFIRNKHLLRGDSRHNISELEWLSDEDGDDDKGSQIEDRRRGYSNC
FT                   WGEKLQNLF"
FT   CDS             5715. .7097
FT                   /db_xref="SPTREMBL:Q9WSQ6"
FT                   /note="ORF2"
FT                   /product="hypothetical protein"
FT                   /protein_id="CAB46652.1"
FT                   /translation="MATMIRGHKLKIAEGDIPIAGVKSSRIYSDVSPFKRASDLMIHWN
FT                   EFVFKVMPEDIAGDGFRLASMPVIPSSEVQAVLRKRESTNYVHWGALSISIDALFRKNA
FT                   GVSGWCYVYDNRWETFEQAMLQKFHFNLDSGSATLVTSPNFPVSLDDPGLSNSISVAVM
FT                   FENLNFKLESYPISVRVGNMCRFFDSFLSSVKNKVDSNFLLEAANADPLGVGAFGFEQD
FT                   DQVSELFNYIHTVPTQAIKSREHEIPKGLFGMLGKKKVKSFEFASGSRSMGRIKPYRGM
FT                   QFERSSSQRIVPGFRSQDDKNEYQSLSTDSDFENFLKRKDKGKAGAKSIASEGSSIDNI
FT                   SPREFQFARQNKKKEDGSSSELAAKGGRRSESIPGRRRQTPSWKDRGNPGTDTGVHLRE
FT                   HSNPRNVGADGVSWTNGGGEVNGGSEGDRILQFEGGRQPDQGLQDYLFGPEYQQYDLPA
FT                   GV"
FT   CDS             6610. .7362
FT                   /db_xref="SPTREMBL:Q9WSQ5"
FT                   /note="ORF3"
FT                   /product="hypothetical protein"
FT                   /protein_id="CAB46653.1"
FT                   /translation="MIKMNIKAYQLTVILKIFSKGRTKVKLGPNPLLQRGHPLTTYLQE
FT                   SFSLLDKIRRRRMAAVLNLQLKVDADLKAFLGAEGRPLHGKTGVILEQILESIFANIAI
FT                   QGTSEQTEFLGLTVEVKSMEDQKVIGSYNLREVVNLIKAFKITSSDQNINNMTFRQVCE
FT                   AFAPEARNGLVKLKYKGVFTNLFTTMPEVGSKYPELMFDFNKGLNMFIMNKAQQKVITN
FT                   MNRPLLQTEFAKSENEAKLSSVSTDLCI"
FT   CDS             6781. .7362
FT                   /db_xref="SPTREMBL:Q9WSQ4"
FT                   /product="coat protein"
FT                   /protein_id="CAB46654.1"
FT                   /translation="MAAVLNLQLKVDADLKAFLGAEGRPLHGKTGVILEQILESIFANI
FT                   AIQGTSEQTEFLGLTVEVKSMEDQKVIGSYNLREVVNLIKAFKITSSDQNINNMTFRQV
FT                   CEAFAPEARNGLVKLKYKGVFTNLFTTMPEVGSKYPELMFDFNKGLNMFIMNKAQQKVI
FT                   TNMNRPLLQTEFAKSENEAKLSSVSTDLCI"
XX
SQ   Sequence 7545 BP; 2375 A; 1352 C; 1827 G; 1991 T; 0 other;

AJ243438  Length: 7545  December 21, 2001 15:38  Type: N  Check: 6693  ..
       1  tgatactgat acagtgtaca ctcacgtcgt gagtaaacag attgacgtaa
      51  cgcctcaatc gtggtcaagg accagcatta ctatgctatc acattaaata
     101  caatcacatt gtattccaaa actttccgtc taatcgcgtg aaaggttaca
     151  aatggctttc tcttacagaa cgccacaaga agagctcctg agcagactac
     201  cccagtctca acaggaagtt ataagtggat tccaatatga acgcattcaa
     251  aaggaagagg agaagaaggt ggaaaacctc ttcttttacc taccagagaa
     301  aactagggaa tggtttacta agtcgggtgt ttatctatca ccattcgctt
     351  atgttaatca ctctcaccct ggttgcaaaa ctctggagaa ccacctttta
     401  tttaacgttg tagctagcta tattagtaaa tattcttatg tagcgtgtct
     451  tagtattaag tccaataaaa tgagcaagat ggaacgattg ggttccaatt
     501  ctgttaagac ttatgacatt ttgaataggt tagttacagt caaaggcaag
     551  ggccgttatg gacctttagc aaaacccgag aggtctccat gtccaaagaa
     601  aaccaacatt ttcatccatg atgaaattca ttactggtca agagaccagc
     651  ttgagacatt tctacaggtc cacagaccta aaaatttatg ggcaaccttg
     701  gtgtttcccc ctgagatatt ggcaggttat aaatcgtccg tccttccatt
     751  tctttaccaa tttgagattc atggtaaaga cctggtttac atgcctgatg
     801  gagtgaggtc agaaagttac actcaacccc ttgaaaatgg ttacctcctg
     851  agctcaagta gtatacttgt cagaaacaag accacaggag ttgaaatgag
     901  gtaccaagtt agtctcatat attcattggg ctcccatcac ttgttccata
     951  tttacccaac tgaggattta atgaaagagg aagtgcggag atttgggccc
    1001  tatgatctct ttgatgttgg ttcacttttt gttaagcccg tgcgggttcc
    1051  gatccaggac tttcctctga gcgtattcaa gaaaatcttc atctacataa
    1101  gctcactgaa gaggcctggt gtgcaatcag cagtggctaa attgaggcag
    1151  ttatccgatg ctgacatttc aattgaaagc gtcttcatgg tgcaggagtt
    1201  tgccagcagg atagagaaag atggagtgga gaaatggtcc tgttcctttt
    1251  ggggatgcat gaaagattgg ttctttgaca aattaccata cagagaggtc
    1301  ttggaaaaga taggactggc tgatgatttc acaagaagat tgatgaaaat
    1351  caagccgctt gcattcgaca ttcacaccac agacagacca ttgactgaca
    1401  gaatggtaat agatcaaatt tgggaggaaa gacaaagttc ctgtgatgac
    1451  atcccaaata tagtcttcta tggaagaaaa gagtggattg agcatggggt
    1501  tgtgccaaaa ataaaaaaaa gtctggctaa actgattccc gggagggaaa
    1551  tggagtctag tgattacccc aaggaaattt attctgattt gctatcttca
    1601  acatcaatct ggagatcata tgatgatgat ctaaggcata ggaatgccag
    1651  tcccactgtg gtactaaaat cgagtagaag ctactcagag gcagcaggat
    1701  ttaactctca ttgtctgagc atatgtgcaa ctgctcacga tgaagtagtc
    1751  atgaagacac cttttgaact caagcgtgaa gctaataaga aggaattgtc
    1801  tatgcattgc ctgaattttc acatgaagaa gatgaaggtg aaaagcttac
    1851  cggagcttga ggccaagctg aatgagcatg gcaaaggaat ctttaggaag
    1901  aaggaaggaa ccagaaaggt caagaggcca aggatggtcc cggtgcatct
    1951  gctcaagcaa gtcaatgatg tcaaaggtga taagatcaat gaggaaacga
    2001  gaaggaagcc gaatccccag ccaggtaaaa gaaggaatga aggagagaaa
    2051  gatgtgagcc cccatgatga agggtttccg gtggagtgca ccaaaacaaa
    2101  tgcgcaatca gctcagaagt tccccacaag ctccaagttg agtgatttaa
    2151  ttggaaagac acaactctcg tcacgtggtt tgattaaaac tgttgggaat
    2201  gattaccttg ccttggcgga gcaaatagag tgcatgccac tctctcaact
    2251  caagaacaag aaagcggcat atttctgcct tgattttccc atggtctatt
    2301  ttcatgacag agtttcctat ccagctttcg aagcaacagg ggaaattaga
    2351  caagtcataa tgagggcaag agataaatgg ggaatcaatt tcaacagtgc
    2401  attgatccaa gtctacaatg atgggtgcag attacccttg cacagtgaca
    2451  atgaggagtg ttatgatgat gatggaattc tcacaattaa tgttaaagga
    2501  gatgcaaaat tccacaccac ttgccatgat gaggttatag aactcaagca
    2551  agggaacgag atactgatgc cagcaggtta tcaaaagagg aataggcacg
    2601  ctgttgaagt tgattctgaa gggaggacaa gcgtcactct cagagtgcac
    2651  aagagggact tcagctttga atctaaactc agattcatca agggcaagtt
    2701  tgattgcctc tttgttagca ttgccgagat aatacacaaa aaaccagaag
    2751  aggttatgat gttcatccca catattatgg acagatgcgt aagtaataaa
    2801  ggttgttcgc ttgatgatgc aaaggcaata tgcgagaggt acgagattaa
    2851  aatagaatgt gagggtgact gtggcttggt cgaatgtgga acatcggggc
    2901  tctcggtcgg tagaatgctg ctgagaggaa accacttcac tgttgcttct
    2951  gttaggaggt cctccattga ttcacttgct aactcatcaa aagagatcaa
    3001  gtcaaatggt gttttggatc atgtgacgtt taactttcac aaaagactta
    3051  aactggttga gcctgatttg acaatggtgg acacaaaggt ggatccctcc
    3101  agggcaggaa agctgcttaa gagtttaatg gatggtatga ctgggattgt
    3151  ctctcacaat tcaacccatg aagggtggag gatgattaag gggataaaca
    3201  gcacctctga gatgagatca ttcatgagca tgattaaagg tcaatgtgag
    3251  gatacaaaaa gcgatctgtt tgacaaggtt caagagttga atttcatgaa
    3301  ggtgaagata tatggcatct tcgggtttgc tggatctggg aagagtcatg
    3351  caatacaaaa tttaatccaa actgaattca agggttctca gggagtgatg
    3401  gtgatttgtc ccagaagatt tttggcaaag gactggagtg aaaagggagt
    3451  ggatgaaaag gacatcaaaa ccttagagag tgcgctaaag tcagacatca
    3501  aaggaaagag gctgttcata cttgatgaag tcagtttact acccaagggc
    3551  ttcaccgatc ttatcatgct caaaatgcat atggaagaga ttctgaagaa
    3601  atcaacgatt gtctgtattg gcgacccact tcaagctggg tacttctgtc
    3651  ctaaggatga cagttatctg tctagggaag gagagattaa aaggttattc
    3701  aaggatggtg taaattacaa gtggtacagt tacaggatca acaaatttgt
    3751  cgcaaagaag ttggccattg aaacaatgaa tgacttcatt ggaatagatg
    3801  agcaaagctc aatctacaag gatatgccat ctgccaatca cttcatggaa
    3851  aagaaaggga atcatataga agtgattctc gttgccagca tggttgaaaa
    3901  ggaactctat tccaattatg gcaacgtcat gacattcgga gaatcacagg
    3951  gtttgacatt caattgtgga gtgattgtac tttctgagga agccaagctg
    4001  tgctctgatg cgcacataat ggtagcaata acaagattta gaagaggctt
    4051  ctgttttgca ttgggaagca aaggttcgaa agaggattac atgagatcaa
    4101  tgaagagtgg attgctccag aggatgtgtt cgggaattgg tgcttcaaaa
    4151  gagttcatct tgggatcctc ctctgtcagt ttgaatttga gcgaaaagga
    4201  tattactagg ggagcaggtg tcgatgaaat ggatagagaa gccaggttgg
    4251  aaggagatgt ctggctcaaa agcatgatat accttgggaa aagataccac
    4301  atgatcgaac cgctcggcca ggtgattaaa ctgacagaca gtgcaatcaa
    4351  gtgtcacatt ccggtttgct caagtcaaac cctaggtcct gagcttgaca
    4401  atattcaagc aagggaattc agggaattca aaggaaaaaa tggatggtcg
    4451  aaccaattca gagaggaggc cgggccaaat tggagatttc cttacaaagt
    4501  gaatcaggca atgagctatg aggctgtata cccaagacat agaatggatg
    4551  atgacctcac cttcctggca gcaataaaga aaaggctgcg ttttgacaat
    4601  gttgccaaca attacgcaaa attcaaggca gctgaaaaca gagggaagta
    4651  cttggcaaaa attttcctca agcatgttcc tatcaaatgt ggcagagatc
    4701  aaaggctttt ggatcaatgt aggcaggaat ttgaggagac aaaactgtca
    4751  aaaagtgcag cgacgattgg agcgcactct cagaggtcag actcagattg
    4801  gcctttggac aaaattttct tgttcatgaa atctcaattg tgtacaaaat
    4851  ttgaaaaaag gttcaccgaa gccaaagcgg gtcaaacctt ggcttgtttc
    4901  ccacacaaga tccttgtgga atttagtcca tggtgcaggt acacagaaaa
    4951  ggttctctcc gcgaatctgc cggataacta ctacatacat caaaggaaga
    5001  atttcagtga actcgaggat tttgcaaaaa gattttcaaa cggctcagta
    5051  tgtgtggaat cagattatac ggcttttaac gtctcgcaag atcacactat
    5101  tttggcattc aaggtggagc tcctcaagca tttcggttgg gatgacagta
    5151  ttcttcaaag ttacatcaaa atgaaatgca ctttgggttg cagacttggt
    5201  ggttttgcta tcatgagatt cacaggggag ttttcaactt tcttattcaa
    5251  cacacttgcg aacatggttt tcacattctg cagatatgag gttcctgatg
    5301  gaactccaat ttgcttcgct ggagatgata tgtgtgcttt gaggaatttg
    5351  agagaaatag acacccatga gttcattctg aacaaattga gcctgaaggc
    5401  caaagtgaac agaacgagag ttccaatgtt ctgcggctgg cgtttgtgtt
    5451  gcgatggttt gatcaaagag ccatgtttga tctatgaaag actgcaggtt
    5501  gcaattgaaa atggaagatt gatggatgtg atagactcat attttctgga
    5551  attttcattc gcctacaaat taggtgagag gctttattca catcttgaaa
    5601  ttgaacagct gaattatcat caggttttga caagattctt cataagaaac
    5651  aaacatctgt tgagaggaga ttcaagacac aacatttctg aacttgagtg
    5701  gttgtctgac gaggatggcg acgatgataa ggggtcacaa attgaagatc
    5751  gcagaagggg atattccaat tgctggggtg aaaagctcca gaatctattc
    5801  tgacgttagt cctttcaaga gggcatctga cctcatgatc cattggaacg
    5851  aattcgtttt taaggtcatg cctgaggaca tagcagggga cgggtttagg
    5901  ttggcatcaa tgcctgtcat accttcatct gaggtgcaag cagttctgag
    5951  gaaaagagaa agcacaaatt atgtgcattg gggggcatta tccatatcaa
    6001  ttgatgcttt gttcaggaag aatgcaggtg tgtcaggttg gtgctacgtg
    6051  tatgacaata gatgggagac atttgagcaa gcgatgctgc agaaatttca
    6101  ttttaacttg gatagcggtt ccgccacctt ggtgacctca cccaatttcc
    6151  ctgtttcatt ggatgatcca ggcctttcta actctatcag cgtggctgtg
    6201  atgtttgaga accttaattt caagttagaa agctacccaa tcagtgtgag
    6251  agtaggtaat atgtgcaggt tctttgacag tttcctgagc agtgtcaaaa
    6301  acaaagttga ttcaaatttc ctgcttgagg ccgcaaatgc ggatccgctg
    6351  ggggtagggg cctttgggtt tgagcaggac gatcaggtga gtgagttgtt
    6401  caactacatt catacagttc caactcaggc catcaaatcg agggaacatg
    6451  aaatcccaaa aggattgttt ggaatgctag gaaagaagaa ggtcaaatcc
    6501  tttgagttcg cctcgggatc aaggagtatg ggaagaataa agccgtatag
    6551  agggatgcaa tttgagaggt cctccagcca aagaattgtt cctggattta
    6601  ggtcccagga tgataaaaat gaatatcaaa gcttatcaac tgacagtgat
    6651  tttgaaaatt ttctcaaaag gaaggacaaa ggtaaagctg gggccaaatc
    6701  cattgcttca gaggggtcat ccattgacaa catatctcca agagagtttc
    6751  agtttgctag acaaaataag aagaaggagg atggcagcag ttctgaactt
    6801  gcagctaaag gtggacgcag atctgaaagc attcctgggc gcagaaggca
    6851  gaccccttca tggaaagaca ggggtaatcc tggaacagat actggagtcc
    6901  atcttcgcga acatagcaat ccaaggaacg tcggagcaga cggagtttct
    6951  tggactaacg gtggaggtga agtcaatgga ggatcagaag gtgataggat
    7001  cttacaattt gagggaggtc gtcaacctga tcaaggcctt caagattacc
    7051  tcttcggacc agaatatcaa caatatgacc ttccggcagg tgtgtgaggc
    7101  ctttgcgcct gaggcaagaa atggtctggt aaagctaaag tataaagggg
    7151  ttttcacaaa cctttttaca acaatgccag aggtggggag caaataccct
    7201  gaactcatgt ttgacttcaa taagggcctt aacatgttta tcatgaacaa
    7251  ggctcagcaa aaagtaataa ctaatatgaa tcgaccgctt ttacagactg
    7301  aatttgcaaa aagtgagaat gaggcgaaac tctcgtctgt gtcaactgac
    7351  ctttgcattt agactgttca ggatgtttgg tttaataaat aaaataaata
    7401  aatagcgtgt ttaaattgat acttaaatat gtttgatgaa taaacaaact
    7451  cttgaaccca tgaaagagta taaagagtca tggtatttaa ttggagtgtt
    7501  tagacttata ataaatagcc tgtagacttt taaatatttt actac