ID   AY038068; SV 1; linear; genomic RNA; STD; VRL; 1017 BP.
XX
AC   AY038068;
XX
DT   31-JUL-2001 (Rel. 68, Created)
DT   10-JAN-2009 (Rel. 98, Last updated, Version 2)
XX
DE   Pelargonium ringspot virus putative coat protein (CP) gene, complete cds.
XX
KW   .
XX
OS   Pelargonium ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae.
XX
RN   [1]
RP   1-1017
RA   Kinard G., Guaragna M.A., Jordan R.;
RT   "Characterization and genome organization of four unique viruses infecting
RT   geranium and their assignment to a new provisional genus in the
RT   Tombusviridae family (#VP64.13)";
RL   (in) Unknown A. (Eds.);
RL   XITH INTERNATIONAL CONGRESS OF VIROLOGY:415-415;
RL   Unknown Publisher (1999)
XX
RN   [2]
RP   1-1017
RA   Jordan R.;
RT   ;
RL   Submitted (05-JAN-2001) to the EMBL/GenBank/DDBJ databases.
RL   Floral & Nursery Plants Research Unit, USDA, ARS, US National Arboretum,
RL   10300 Baltimore Ave, Bldg 010A, Room 238, Beltsville, MD 20705, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1017
FT                   /organism="Pelargonium ringspot virus"
FT                   /isolate="DSMZ-PV0304"
FT                   /mol_type="genomic RNA"
FT                   /note="PelRSV"
FT                   /db_xref="taxon:167020"
FT   gene            1. .1017
FT                   /gene="CP"
FT   CDS             1. .1017
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="putative coat protein"
FT                   /db_xref="GOA:Q911J5"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q911J5"
FT                   /protein_id="AAK74063.1"
FT                   /translation="MASNSPIVLAAANRGEVWAVKLKQSGWKTLSKAQKAAARAQGIGA
FT                   APLSQTVPKTTRIIQGNPTFSRRSRDAPGNAQKSMTIVKSEFLGEVSADGAIHTYTLDP
FT                   RNVRTFPHISDLARGFNKYKFGDLKVRYSAKVQESGCGVCIAFTPDSSDPKPKGKFDLY
FT                   SLGSRAEGAAHRNLLYTVPIDKSQRFLRDCATENSKDVDAGSLFVLVDGQHDGRVGELF
FT                   LEVTIVLSQPTYNQRATQLLAGTTHRDGPTFVKAVKSANTVSLTFQAAGNYLVSTYSSL
FT                   LERVGRLALGEAEQSQVDSSTHSSNVVEALVAAPGGSIVYYFKTPDQMSFRAYVCRM"
XX
SQ   Sequence 1017 BP; 254 A; 253 C; 275 G; 234 T; 1 other;

ay038068 Length: 1017  10-JAN-2009  Type: N  Check: 6364  ..
       1  atggccagca atagtcccat agtactggcg gcggctaacc ggggtgaagt
      51  ttgggcggtc aagctgaagc aatctgggtg gaagacgctt agcaaggctc
     101  agaaggcagc tgctcgtgct caaggcatag gagctgcccc attgagccag
     151  actgtgccga agaccaccag gattatacaa ggaaacccaa ccttctcccg
     201  tcgatcccga gatgctcccg ggaacgctca gaaatccatg accatcgtga
     251  agtctgagtt tcttggagag gtttcggcag atggggcaat ccacacttac
     301  acacttgatc cccgcaacgt tcgaaccttt ccccatatct ccgacctggc
     351  ycgtgggttc aacaagtaca agtttgggga cttgaaagta cgatatagcg
     401  ccaaggtcca ggaatctggc tgtggcgttt gtattgcttt caccccggat
     451  tcatctgacc ccaagccgaa aggtaaattc gatttatact cacttggaag
     501  tagggctgaa ggggccgctc atcgaaacct gctatacaca gtcccaattg
     551  acaaatctca aagattcttg agagactgtg cgaccgaaaa ttcaaaagac
     601  gtggacgctg gtagtttgtt tgtgttggtg gatggccagc acgatgggcg
     651  agtcggggaa ctcttcctcg aagtgaccat tgtgttgagc cagcccacgt
     701  acaaccagcg ggccacacaa cttttggcag gtaccacaca cagagacgga
     751  ccgacttttg tgaaggcagt gaaaagcgct aataccgtct cgttaacttt
     801  ccaggcagct ggtaactacc tggttagcac gtatagctct ctgctggaac
     851  gggttggtcg gctcgcgttg ggcgaggcag aacaatcaca ggtggattcg
     901  tccacacaca gtagcaatgt agtagaagct ctagttgccg cacctggcgg
     951  aagtattgta tattacttta agacccctga tcagatgtcg ttcagggctt
    1001  atgtttgccg tatgtga