!!NA_SEQUENCE 1.0
ID   APC2165K   standard; RNA; VRL; 7552 BP.
XX
AC   D14996;
XX
SV   D14996.1
XX
DT   14-DEC-1993 (Rel. 38, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 7)
XX
DE   Apple chlorotic leaf spot virus genomic RNA, complete genome.
XX
KW   .
XX
OS   Apple chlorotic leaf spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Trichovirus.
XX
RN   [1]
RP   1-7552
RA   Yoshikawa N.;
RT   ;
RL   Submitted (14-APR-1993) to the EMBL/GenBank/DDBJ databases.
RL   Nobuyuki Yoshikawa, Iwate University, Bioscience and Technology; Ueda
RL   3-18-8, Morioka, Iwate 020, Japan (Tel:81-196-23-5171(ex.2516),
RL   Fax:81-196-25-7667)
XX
RN   [2]
RP   1-7552
RX   MEDLINE; 93389448.
RX   PUBMED; 8376968.
RA   Sato K., Yoshikawa N., Takahashi T.;
RT   "Complete nucleotide sequence of the genome of an apple isolate of apple
RT   chlorotic leaf spot virus";
RL   J. Gen. Virol. 74:1927-1931(1993).
XX
DR   GOA; P54890.
DR   GOA; P54891.
DR   GOA; P54892.
DR   SWISS-PROT; P54890; COAT_ACLSA.
DR   SWISS-PROT; P54891; RRPO_ACLSA.
DR   SWISS-PROT; P54892; V51K_ACLSA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7552
FT                   /db_xref="taxon:12175"
FT                   /mol_type="genomic RNA"
FT                   /organism="Apple chlorotic leaf spot virus"
FT                   /isolate="P-205"
FT   CDS             152. .5809
FT                   /codon_start=1
FT                   /db_xref="GOA:P54891"
FT                   /db_xref="SWISS-PROT:P54891"
FT                   /product="216.5K protein"
FT                   /protein_id="BAA03641.1"
FT                   /translation="MAFSYRTPQEELLSRLPQSQQEAISGFQYERFQKEEEKKVENFSF
FT                   YLPEKTREWFTKSGVYLSPFAYVNHSHPGCKTLENHLLFNVVASYISKYSYVACLSIKS
FT                   NKMSKMERLGSNSVKTYDILNRLVTAKDKARYGPLARPERSPCPKKTNIFIHDEIHYWS
FT                   RDQLETFLQVHRPKNLWATLVFPPEILAGYKSSVLPFLYQFEIHGKDLVYMPDGVRSES
FT                   YTQPLENGFLLSSSSILVRNKATGVEIRYQVSLVYSLGSHHLFHIYPTEDLMKEEVRRF
FT                   GPYDLFDVGSLFVKPVRVPIQDFPLSVFKKIFIYLSSLKKPDVQSAVAKLRQLSDADIS
FT                   IESVFMVQEFASRVEKNGVGSWSCSFWECMKDWFFDKLPYREVLEKIGLANDFTRRLMK
FT                   IKPLAFDIHTTDRPLTVRMVIDQIWGERQSSCDDVPNIIFYGRKEWLEHGLLPKVKKGL
FT                   AKLVPGRETGGSDYPEEIYSDLLSSTSIWRSYDENLRHRKASPIVILKSEKAYSEAPGF
FT                   SSNCISLCSTPFGEVIERTPFEVERERKKRELSFGCLDFHIRKMKVKDASELSIKLDEQ
FT                   NKEGLRRQKRKEKAKKTRMIPVHLLELGSDQKEKNLGQEASKGKGIEQEERRKSDEAKF
FT                   DSGPSGVCSIKAENPVDAQHIAEPVPCLKLNDLIGKEKICSSGLIKTVGNDYLTLARQI
FT                   EDMPLAQLKNRKAAYFCIDYPMVYFHDKISYPTFEATGEIKQIIMRARDKWGANFNSAL
FT                   IQVYNDGCRLPLHSDNEECYDDDEILTINVVGDAKFHTTCHGEIIDLRQGDEILMPGGY
FT                   QKMNKHAVEVASEGRTSVTLRVHKRDFSFESKLRFIKGKFDCLFVSIAEIIHKKPEEVM
FT                   MFIPHIVDRCVSNRGCSLDDARAICEKYEIKIECEGDCGLVECGTIGLSVGRMLLRGNH
FT                   FTVASVRRSSMDSLANSSKELKSNGVLDHVMFNFHKRLRSVEPDLTVEEIKVDSSRAGK
FT                   LLKSLMDGMTGIVSHNSTHEGWRMIKGINSTSEMRSFMSMIKGKSEETRGDLFDRVQEL
FT                   NFMKVKIYGIFGFAGSGKSHAIQNLIQTEFKGSQGVMVICPRRFLAKDWSEKGVDEKDI
FT                   KTFESALKSDVKGKRLFILDEISLLPKGFTDLLMLKMHMEGILKKSTIVCIGDPLQAGY
FT                   FCPKDDNYLSREGEIKRLFKDGVNYKWYSYRINKFIAKKLAIETMNDFIGIDEQNLIYK
FT                   DMPSAHHFMENKGNHIEVILVPSMIEKELYSNYGNVMTFGESQGLTFNCGVIVLSEEAK
FT                   LCSDAHIMVAITRFRRGFCFALGSKGSKEDYMRSMKSGLLQRMCSGIGASKEFILGSSS
FT                   VKLILSEKDVSKGAGVDEMDREARLEGDVWLKSMIYLGKRYHIVEPLGQVIKLTENAIK
FT                   CHIPVCSSQTLGPELDNIQAREFREFKGKNGWSNQFREEAGPNWKHPYRVNQAMSYEAI
FT                   YPRHRMDDDLTFLAAIKKRLRFDNVANNYAKFKAAESRGKYLAKVFLRHVPIKCGRDQR
FT                   LLDQCRQEFEETKLSKSAATIGAHSQRSDSDWPLDKIFLFMKSQLCTKFEKRFTEAKAG
FT                   QTLACFPHKILVEFSPWCRYTEKVLTANLPDNYYIHQRKNFSELEDFAKRFSNGSMCVE
FT                   SDYTAFDVSQDHTILAFEVELLKHFGWDDKVLQSYIKMKCTLGCRLGGFAIMRFTGEFS
FT                   TFLFNTLANMVFTFCRYEVPDGTPICFAGDDMCALRNLREIDTHECILSKLSLKAKVNR
FT                   TKVPMFCGWRLCFDGLIKEPCLIYERLQVAIENGRLMDVIDSYFLEFSFAYKLGERLYS
FT                   HLEIEQLNYHQVLTRFFIRNKHLLRGDSRHNISELEWLSDEDSDDDKGSQIEDRRRGYS
FT                   NCWGEKLQNLF"
FT   CDS             5727. .7100
FT                   /codon_start=1
FT                   /db_xref="GOA:P54892"
FT                   /db_xref="SWISS-PROT:P54892"
FT                   /product="50.4K protein"
FT                   /protein_id="BAA03642.1"
FT                   /translation="MMIRGHKLKIAEGDIPIAGVKSSRIYSDVSPFRKASDLMIHWNEF
FT                   VFKVMPEDIAGDGFRLASIPVIPSSEVQAVLRKRESTNYVHWGALSISIDALFRKNAGV
FT                   SGWCYVYDNRWETFEQAMLQKFRFNLDSGSATLVTSPNFPVSLDDPGLSNSISVAVMFE
FT                   NLNFKLESYPISVRVGNMCRFFDSFLSCVKNKVDSNFLLEAANADPLGAGAFGFEQDDQ
FT                   VSELFNYIQTVPTQAIKSREHEVPRGLFGMMGKKKVKSFEFASGSRNLGRRKPQRGRPL
FT                   ERSASLRVAPGFRSQDERVEHQGLSTDSDFENFLRKGKGKAGTESITSEGSSFDNISAR
FT                   EFQFARQDQKAKDGGSAEPPIKSGRRSESVPGRRRQTPSWKDRGNSGTDTGGHLREHSD
FT                   TGDLGTNRVPGRAGGGEIHGGSEGGGVIQSEGGSRFDQNIQDYIFGPEYKQHDLPPSV"
FT   CDS             6784. .7365
FT                   /codon_start=1
FT                   /db_xref="GOA:P54890"
FT                   /db_xref="SWISS-PROT:P54890"
FT                   /note="21.4K protein"
FT                   /product="coat protein"
FT                   /protein_id="BAA03643.1"
FT                   /translation="MAAVLNLQLKVDADLKAFLAAEGRPLHGKTGAILEQTLEAIFANI
FT                   AIQGTSEQTEFLDVLVEVKSMEDQKVVGSFNLKEVVGLIKIFRTTSSDPNISSMTFRQV
FT                   CEAFAPEARNGLVKLKYKGVFTNLFSTTPEVGGKYPELMFDFNKGLNMFIMNKAQQKVI
FT                   TNMNRRLLQTEFAKSENEAKMSSVTTDLCV"
FT   polyA_site      7552
XX
SQ   Sequence 7552 BP; 2297 A; 1314 C; 1885 G; 2056 T; 0 other;

  D14996  Length: 7552  July 15, 2003 09:10  Type: N  Check: 4168  ..
       1  tgatactgat acagtgtaca ctcacgtcgt gagtaaacag attgacgtaa
      51  cgcctcaatc gtggtcaagg accagcattt taatgctaca acgttaaata
     101  caatcccatt gtattcaaga actttccgtt taactacgtg aaaggttaca
     151  aatggctttc tcttatagaa cgccacagga agaacttctg agcaggttac
     201  ctcagtctca gcaggaagcg atcagcggat ttcagtacga gcgatttcaa
     251  aaggaggaag agaagaaggt ggaaaacttc tctttttacc taccggagaa
     301  gaccagggag tggttcacta agtcaggtgt atatctctca ccctttgctt
     351  atgtcaatca ttctcaccct ggttgcaaaa ctctggagaa ccacctttta
     401  tttaatgttg tagctagtta tattagtaag tattcttatg tagcttgtct
     451  tagtattaag tcgaataaaa tgagcaagat ggaacgtttg ggttccaatt
     501  cagtcaaaac ctatgacatt ttgaacagat tagttactgc taaggacaag
     551  gctcgatatg gacctttggc caggcctgag cggtctccat gtccaaagaa
     601  aacaaacatt ttcattcatg atgagatcca ttattggtca agggatcaac
     651  ttgagacatt ccttcaggtt cacagaccca aaaatttgtg ggcgactctt
     701  gtttttcccc ctgagatctt ggctggttat aagtcgtcag ttttaccatt
     751  tctttaccag tttgagattc atggaaaaga tttggtttac atgcctgatg
     801  gagttagatc agagagttac actcaacctc ttgagaatgg atttcttctg
     851  agttcaagca gtatacttgt gagaaacaag gctactggag ttgaaattag
     901  atatcaggtt agtcttgtgt attctctggg ttctcaccat ttgttccaca
     951  tttaccccac ggaggacctg atgaaagaag aggtgagaag gtttggacct
    1001  tatgatttgt tcgatgtggg ttcattattt gtcaagccag tgcgcgtccc
    1051  tatccaagac ttccctttga gtgtcttcaa aaagatattc atttatctta
    1101  gttcattaaa gaagcctgat gttcagtctg cagtggccaa actcagacag
    1151  ttatccgatg ccgacatttc cattgagagt gttttcatgg tgcaggagtt
    1201  tgcaagtagg gtggaaaaaa atggagtcgg aagttggtcc tgctcatttt
    1251  gggagtgcat gaaggactgg ttttttgata agctgccata cagagaggtg
    1301  ctggaaaaaa ttggattggc gaatgacttt accaggcgtt tgatgaaaat
    1351  caaaccattg gctttcgata tccacacaac agacagacca ctcacagtca
    1401  ggatggtcat agaccagatt tggggagaga ggcaaagctc ttgtgatgat
    1451  gttccaaata ttatatttta tggaaggaag gaatggcttg agcatgggct
    1501  attgcctaag gtgaagaaag gcttagccaa attggttcca ggaagggaga
    1551  ctggtggaag tgattaccca gaagaaatct attctgattt gctgtcatcc
    1601  acctcaattt ggaggtctta tgatgagaat ctaaggcaca ggaaagccag
    1651  tcctattgtg atacttaagt ccgaaaaggc atactctgag gcccctgggt
    1701  tcagctcaaa ctgtatcagc ctgtgttcta cgccttttgg tgaggttatt
    1751  gaaaggaccc cttttgaggt ggaaagggaa aggaagaaaa gagagttgtc
    1801  ttttggttgt cttgattttc acattagaaa gatgaaggtt aaagatgctt
    1851  ctgaactttc catcaagttg gatgagcaga ataaagaagg tttgaggagg
    1901  cagaaaagaa aggagaaggc gaagaaaaca aggatgattc ctgtgcatct
    1951  gctagaatta ggttcagatc aaaaggaaaa gaatttgggg caggaggctt
    2001  ccaaaggaaa aggaattgaa caggaagaga ggaggaaaag tgatgaagca
    2051  aagtttgatt ctgggccctc gggagtttgc agcataaaag cggaaaatcc
    2101  tgttgatgca caacacattg ctgagcccgt gccatgtttg aaattgaatg
    2151  atctgattgg caaagagaaa atctgttctt ctggtcttat caaaacagtt
    2201  ggaaatgatt atctcacttt ggccaggcag atagaggata tgcccctcgc
    2251  ccagttgaag aacaggaaag cagcatattt ctgcattgac taccctatgg
    2301  tgtactttca tgacaagatt tcatacccaa cttttgaagc tactggtgag
    2351  atcaaacaaa tcatcatgag agcaagagac aaatggggtg caaatttcaa
    2401  cagtgctcta attcaggtct ataatgacgg gtgcaggtta cctttgcata
    2451  gcgataatga ggagtgctat gatgatgatg agatactcac gatcaatgtt
    2501  gtcggtgatg caaaatttca cacaacctgt catggtgaaa tcatagatct
    2551  gaggcagggt gatgaaatac tgatgcccgg gggttaccag aagatgaaca
    2601  agcatgctgt ggaagtggca tcggaagggc gaactagtgt tactttgaga
    2651  gtgcacaaaa gggacttcag ctttgagtca aaactcaggt tcattaaagg
    2701  aaaatttgat tgcttgtttg tcagcatcgc ggaaataata cacaaaaaac
    2751  cagaagaggt gatgatgttt atcccacata ttgtggacag atgtgtgagc
    2801  aataggggtt gctcacttga tgacgcaaga gcaatatgtg agaaatatga
    2851  gatcaagata gaatgtgaag gggactgtgg cctagttgag tgtggaacaa
    2901  ttggtctgtc tgttgggagg atgctcctca gagggaatca ttttacagtg
    2951  gcttcggtaa gaagatcatc catggactcc cttgccaatt catcaaaaga
    3001  actcaaatca aatggagtct tggatcatgt aatgtttaat tttcataaaa
    3051  gacttagatc cgtggaacct gatctgactg tagaggaaat caaagtggat
    3101  tcttcaagag cggggaagtt gctcaaaagt ttgatggatg gaatgacagg
    3151  aatagtttcc cacaactcaa ctcatgaggg gtggagaatg atcaaaggca
    3201  taaatagcac ctccgagatg agatcattca tgagtatgat caaaggtaaa
    3251  agtgaagaga ccaggggtga cttatttgac agagttcagg aactgaactt
    3301  catgaaggtt aagatctacg gcatatttgg gtttgctgga tcagggaaga
    3351  gtcatgcaat tcaaaatctc attcagacag aattcaaagg atcacaaggt
    3401  gttatggtga tctgtccaag aaggtttttg gccaaggact ggagtgaaaa
    3451  aggggtggat gagaaggata ttaaaacctt tgagagcgca ctgaagtcag
    3501  atgttaaagg aaagagatta ttcatacttg atgaaatcag tttgttgcct
    3551  aaaggtttca ctgacctctt gatgctcaaa atgcatatgg aagggattct
    3601  gaaaaagtca acaattgtgt gtattggtga ccctctgcaa gctgggtact
    3651  tctgtcctaa ggatgacaat tatttgtcta gggagggaga aatcaagagg
    3701  cttttcaaag atggggtcaa ttacaaatgg tacagctaca ggattaataa
    3751  gtttattgca aagaagctgg ccatagagac aatgaatgac tttattggca
    3801  ttgatgagca gaatttaata tacaaagata tgccatctgc tcaccatttc
    3851  atggagaaca aagggaatca cattgaagtg attctcgttc ccagcatgat
    3901  agagaaagag ttatactcga attacggcaa tgtgatgact tttggcgagt
    3951  cacagggtct tactttcaac tgtggggtca tagtgctgtc cgaagaggcc
    4001  aagctatgct ccgatgctca tataatggtg gcgatcacaa gatttaggcg
    4051  aggtttctgc tttgcacttg gcagtaaagg gtcaaaggag gattacatga
    4101  gatccatgaa aagtggattg cttcaaagga tgtgctccgg gattggtgct
    4151  tctaaggaat ttattctagg atcctcttca gtcaaattaa tcctgagtga
    4201  aaaggacgtc tcaaagggtg ctggagttga tgaaatggac agagaagcca
    4251  ggttggaagg agatgtttgg ctcaagagca tgatatatct tggaaaaagg
    4301  taccatatag ttgaaccgct aggtcaagtg atcaagctca ctgagaatgc
    4351  gatcaagtgc cacattcctg tttgttcaag ccagactcta ggtcctgagt
    4401  tggacaacat tcaagcaaga gagttcaggg aattcaaggg caagaacggg
    4451  tggtccaatc aattcaggga agaggctggt ccaaattgga agcaccctta
    4501  cagagtgaat caggcaatga gttatgaggc tatatatcca aggcacagga
    4551  tggatgatga tctaaccttt cttgctgcca tcaagaagag gcttcgtttc
    4601  gataacgttg ctaataatta tgcaaagttt aaagcagcag agagtagagg
    4651  caagtactta gcaaaagttt tcttgcgaca tgttccaata aagtgtggaa
    4701  gagatcagag acttcttgat caatgcagac aagagtttga agagaccaaa
    4751  ttgtcaaaaa gtgctgcaac cattggagcg cactcacaaa ggtctgactc
    4801  tgattggcca ttggacaaaa tctttctttt catgaagtca caattatgca
    4851  ccaagttcga gaagaggttc acagaagcca aagcgggtca gactttggcc
    4901  tgctttccgc ataagatact tgttgagttc agcccatggt gcaggtacac
    4951  agagaaagta ctcactgcaa accttccaga taattattac attcatcaaa
    5001  ggaagaactt cagtgaactt gaagattttg caaagaggtt ctcaaatggc
    5051  tcaatgtgtg tggaatcgga ttacacagct ttcgatgtct cgcaggatca
    5101  taccatttta gcctttgaag tggagttgct caagcatttt ggttgggatg
    5151  acaaggtatt acagagttac atcaaaatga aatgcaccct aggatgcaga
    5201  ttgggaggtt ttgccattat gaggttcact ggagagttct caacattcct
    5251  gttcaacaca ctcgcaaata tggtatttac cttttgcagg tatgaagttc
    5301  cagacggcac tccaatttgc tttgcaggag atgatatgtg tgccctcagg
    5351  aacttgagag aaattgacac ccatgaatgc attttgagta agttgagcct
    5401  caaagcaaaa gtgaacagaa caaaggtacc gatgttttgt ggatggaggt
    5451  tgtgtttcga cggacttata aaggaacctt gtttgattta cgaaagattg
    5501  caagttgcaa ttgaaaatgg aaggttgatg gatgtgatag actcatattt
    5551  tctggaattt tcattcgcct acaaattagg tgagaggctc tattcacatc
    5601  ttgaaataga acaactgaat taccatcaag ttttgacaag attcttcata
    5651  agaaacaagc atttgttaag gggtgattca aggcacaaca tctcagagct
    5701  tgagtggctt tcagacgagg atagcgatga tgataagggg tcacaaattg
    5751  aagatcgcag aaggggatat tccaattgct ggggtgaaaa gctccagaat
    5801  ttattctgat gtgagtcctt tcaggaaggc ctctgacctt atgattcatt
    5851  ggaatgaatt cgtattcaag gttatgccag aggatattgc aggtgatggt
    5901  tttagattgg catccatacc tgttatacct tcctcagagg ttcaagcggt
    5951  gctgagaaag agagagagta ccaactacgt gcattgggga gcactatcaa
    6001  tatccattga cgcactgttc agaaagaatg ccggggtttc agggtggtgt
    6051  tatgtgtacg acaacagatg ggaaactttt gagcaggcga tgctacaaaa
    6101  gtttcggttc aacctggata gtggctcggc cacattggtg acctcaccga
    6151  attttccagt ttcattggat gatcctggtt tgtccaattc gatcagtgta
    6201  gcggtgatgt ttgagaatct gaacttcaag cttgaaagct accctataag
    6251  tgttagggta gggaacatgt gtagattctt cgacagcttc ttgagttgcg
    6301  tcaagaataa agtggactcc aactttttgc ttgaggccgc taatgcagat
    6351  ccgcttggcg cgggtgcttt cgggtttgaa caggacgatc aggtctctga
    6401  attgttcaat tatattcaga ctgtcccaac ccaggcaatt aaatccaggg
    6451  agcatgaagt accgaggggt ttgttcggta tgatgggaaa aaagaaggtc
    6501  aaatcttttg agtttgcctc tggttcaaga aatctgggaa gaagaaaacc
    6551  gcaacgcgga agacctttgg aaagatctgc tagcctgaga gttgctcctg
    6601  gatttaggtc ccaggatgag agagttgaac atcaaggatt atcgactgac
    6651  tctgattttg aaaattttct gaggaaaggc aaaggaaaag ctggaactga
    6701  atccattact tcagaagggt catccttcga taacatttct gcaagagagt
    6751  ttcagtttgc tagacaagat cagaaggcga aggatggcgg cagtgctgaa
    6801  cctccaatta aaagtggacg cagatctgaa agcgttcctg gccgcagaag
    6851  gcagacccct tcatggaaag acaggggcaa ttctggaaca gacactggag
    6901  gccatcttcg cgaacatagc gatacagggg acctcggaac aaacagagtt
    6951  cctggacgtg ctggtggagg tgaaatccat ggaggatcag aaggtggtgg
    7001  ggtcattcaa tctgaaggag gtagtcggtt tgatcaaaat attcaggact
    7051  acatcttcgg acccgaatat aagcagcatg accttccgcc aagtgtgtga
    7101  ggcatttgcc ccggaggcaa gaaatgggct cgtaaagcta aagtacaaag
    7151  gggtcttcac aaacctcttt tctactacgc ctgaagtggg ggggaagtat
    7201  ccggagctca tgtttgactt caataagggc ctaaatatgt tcataatgaa
    7251  caaagcccag cagaaagtga taactaatat gaaccggcgt cttttacaga
    7301  ctgaatttgc aaagagcgaa aatgaggcga aaatgtcgtc tgttacaact
    7351  gatctttgcg tttagtctca taaggaagtt tggtttaata aataaagtta
    7401  ataaatagtg tgcatttggt ttaatgtcaa ttgtgtgtat ttaattaacg
    7451  tcaaactctt gaacccatga gagagtataa acagtcatgg tatctaattg
    7501  gagtgtttag acttataata aatagcctgt agacttttaa atattttact
    7551  ac