ID   D16681; SV 1; linear; genomic RNA; STD; VRL; 6496 BP.
XX
AC   D16681;
XX
DT   27-OCT-1995 (Rel. 45, Created)
DT   22-FEB-2008 (Rel. 94, Last updated, Version 3)
XX
DE   Citrus tatter leaf virus genes for 242 kDa protein, 36 kDa protein,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tatter leaf virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Flexiviridae;
OC   Capillovirus.
XX
RN   [1]
RP   1-6496
RA   Namba S.;
RT   ;
RL   Submitted (14-JUL-1993) to the EMBL/GenBank/DDBJ databases.
RL   Contact:Shigetou Namba Univ. of Tokyo, Experimental Farm, Faculty of
RL   Agriculture; 1-1-1 Midori-cho, Tanashi, Tokyo 188, Japan
XX
RN   [2]
RX   PUBMED; 7561769.
RA   Ohira K., Ito T., Kawai A., Namba S., Tsuchizaki T.;
RT   "Complete sequence of an infectious full length cdna clone of citrus tatter
RT   leaf capillovirus; comparative sequence analysis of capillovirus genomes";
RL   J. Gen. Virol. 76:2305-2309(1995).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .6496
FT                   /organism="Citrus tatter leaf virus"
FT                   /strain="CTLV lily"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:33759"
FT   CDS             36. .6353
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="242 kDa protein"
FT                   /note="ORF1"
FT                   /note="viral polymerase protein"
FT                   /protein_id="BAG11544.1"
FT                   /translation="MAFTYRNPLEIAINKLPSKQSDQLLSLTTDEIEKTLEVTNRFFSF
FT                   SITPEDQELLTKHGLTLAPIGFRSHSHPISKMIENHLLYICIPGLLSSFRSVAFFSLRK
FT                   NKVDNFLQMHSVFSHGKIKSLGMYNAIIDGKDKYRYGEVSFTSFRDRVIGLRNQCLTRN
FT                   KFPMVLFLHDELHFLSPFDMAFLFETIPEIDRVVATTVFPIELLFGDKVSKEPRVYTYK
FT                   VHGSSFSFYPDGVASECYEQNLANSKWPFTCSGIQWANRKIRVTKLQSLFAHHVFSFDR
FT                   GRACNEFNHFNKPSCLLADEMRLLTKRFDSAVINRSTVSSLSTYMACLKTANAASAVAK
FT                   LRQLEKRDLYPDELNFVYSFGEDFKNFGMRDDFDVSVLQWVKDKFCQVMPHFIAASFFE
FT                   PTEFHLNMRKLLNDLATKGIEVPLSVIIVDNVNFIETRFHARMFDIAQAIGVNLNLLGR
FT                   RFDYDTESEEYFSENGYVLMPSKSNPDRNWILNSGSLKIDYSRLIKARRFRLRRDFLDL
FT                   ISRGDAPRRQLFLESTSDPKSNPEVPESDATGEAGLSVNDESCQSPKEFCAPMSTEDGQ
FT                   PFEGSIPIDLINCFEPEEVKCPRRKRKNDCVFRAISAHLGIETQDLLNFLVNEDISEEL
FT                   LDCIDEDKGLSHEMIEEVLITKGLSMVYTSDFKEMAVLNRKYGVNGKMYCTIKGNHCEL
FT                   SSKECFVRLLKEGGEAQMSNENLNADSMFDLGKFVHNRERAVKLAKSMARGTTGLLSSF
FT                   DPAFCKSMVTLSELFPENFSSTVGLRLGFAGSGKTHKVLQWINYTPSVKRMFISPRRML
FT                   ADEVEVQLKGTACQVHTWETALKKIDGTFMEVFIDEIGLYPPGYLTLLQMCAFRKIVKG
FT                   QSERILKGKLSELSKTCLNMRCFGDPLQLRYYSAEDTNLLDKTHELDILTKTIKHKYLL
FT                   QGYRFGQWFQELINMPTRVDDSKFSRKFFADISSVKTEDYGLILVAKREDKGVFAGRIP
FT                   VATVSESQGMTISKRVLICLDQNLFAGGANAAIVAITRSKVGFDFILKGNSLKEVQKMA
FT                   QKTIWQFVIEGKSIPMERIVNMNPGASFYESPLDVGNSSIQDKASHDLFIMPFINLAEE
FT                   EVDPEEVLGDVIQPVEWFKCHIPVFDRDPMLAEIFDKVAAKEKREVSSILGLSNQFLDM
FT                   EKNGCKIDILPFARQNVFPHHQSSDDVTFWAGVQKRIRKSNWRREKTKFEEFESQGKEL
FT                   LQEFISMLPFEFKVNIKDIEDGEKSFLEKRKLKSEKMWANHSERSDIDWKLDHAFLFMK
FT                   SQYCTKEGKMFTEAKAGQTLACFQHIVLFRFGPMLRAIESAFLRSCGDSYYIHSGKNFF
FT                   CLDSFVTRNAHVFDGFSIESDYTAFDSSQDHVILAFEMALLQYLGVSKEFQLDYLRLKL
FT                   TLGCRLGSLAIMRFTGEFCTFLFNTFANMLFTQLKYKIDPRKHRILFAGDDMCSLSSLK
FT                   RRRGERATRLMGSFSLTAVEEVRKFPMFCGWYLSPYGIIKSPKLLWARIKMMSERQLLK
FT                   ECVDNYLFEAIFAYRLGERLYTILKEEDFEYHYLVIRFFVRNSKLLTGLSKSLIFEIGE
FT                   GIGSEWRSSMSTISSRRSSQQTSRLTQSHPQNFTKMQPFSSRMCSIVSKDLSQMSKFPP
FT                   GLGMDWSCQISSCLMTLKSTQSEKRATSTSTCITESFWLESKQCCQTSEVWKEGSLCMT
FT                   EPVLIRKKAIYARICLSLSLTAVTSVLDLNTAYPPQMPTWRRDSDFVWTFTAHSMNRTL
FT                   SCLLLTLVWPTDVLIQPASWKPRLETQGGPRRLLVAVRHSDLMKKLKWQFWTISLHYFW
FT                   RKVFQMFILKRGCSEVTRLEGHARFLQKGGQTRNRRKREDLGPSQLELKDSEKMSLEDV
FT                   LQQARRHRVGVYLWKTHIDPAKELLTVPPPEGFKEGESFEGKELYLLLCNHYCKYLFGN
FT                   IAVFGSSDKTQFPAVGFDTPPVHYNLTTTPKEGETEEQKKAREGSSGEKTKIWRIDLSN
FT                   VVPELKTFAATSRQNSLNECTFRKLCEPFADLAREFLHERWSKGLATNIYKKWPKAFEK
FT                   SPWVAFDFATGLKMNRLTPDEKQVIDRMTKRLFRTEGQKGVFEAGSESNLELEG"
FT   CDS             4787. .5749
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="36 kDa protein"
FT                   /note="ORF2"
FT                   /note="viral polymerase protein"
FT                   /protein_id="BAG11545.1"
FT                   /translation="MAIVNVNHFLKEVESTDLKIDAISSSELYKDATFFKPDVLNCIKR
FT                   FESNVKVSSRSGDGLVLSDFKLLDDTEIDSIRKKSNKYKYLHYGVILVGIKAMLPNFRG
FT                   MEGRVIVYDGACLDPEKGHICSYLFKFESDCCYFGLRPEHCLSTTDANLAKRFRFRVDF
FT                   HCPQYEQDTELFALDIGVAYRCVNSARFLETKTGDSGWASQAISGCEALRFNEEIKMAI
FT                   LDHKSPLFLEEGVPNVHIEKRLFRGDKIRRSRSISAKRGPNSKPQEKRGFRSLSARIER
FT                   FGENEFGRRASTSEAPPGRSVSLEDTYRPGKGTSDGSSP"
XX
SQ   Sequence 6496 BP; 1933 A; 1235 C; 1505 G; 1823 T; 0 other;

d16681 Length: 6496  22-FEB-2008  Type: N  Check: 7752  ..
       1  aatttaacag cgcttaattt ccgcgcttta cgtcaatggc tttcacttac
      51  agaaatccgc tagaaattgc aatcaacaaa cttccaagca agcaatctga
     101  tcaattgctt tccttgacca cagacgagat tgaaaagacc ttagaagtga
     151  caaatcgctt cttctctttt tcaatcaccc cagaagatca agaattgttg
     201  accaaacatg gtctaacact tgcgcctatc ggattcagat cacattccca
     251  tccaatatcc aaaatgatag aaaatcatct cttgtacata tgtattcctg
     301  gtcttctatc ttctttcagg tcagttgcct tcttctccct tagaaagaac
     351  aaagttgata atttccttca aatgcattct gtattttcac acggaaaaat
     401  taaatctttg ggaatgtaca atgcaataat tgacgggaag gacaagtata
     451  ggtatggtga ggtctctttc acctctttca gagatagagt gataggtctt
     501  agaaatcaat gccttacgcg taataaattt ccaatggtgt tattccttca
     551  tgacgaattg cactttctta gcccctttga tatggctttt ttatttgaaa
     601  caattccaga aatagacaga gttgttgcaa ccacagtatt tccgattgaa
     651  ttgttatttg gggacaaggt ctctaaggag cctagagttt atacctataa
     701  ggttcatgga tcttcctttt cattttaccc tgacggtgta gcctctgaat
     751  gttatgaaca aaatttggcg aattcgaaat ggcctttcac ctgtagtggc
     801  attcaatggg ccaataggaa gataagggtg accaagttgc agagcttgtt
     851  tgctcaccat gttttttcat ttgacagagg cagggcctgc aatgaattca
     901  accatttcaa taagccaagc tgcctgctcg cagatgaaat gcgtcttttg
     951  acaaaaaggt tcgattctgc agtcatcaat cggagtacag tttcctctct
    1001  cagcacttac atggcttgcc tcaaaactgc gaacgcagct tcagcagttg
    1051  ctaaattgag acagttggag aagagagacc tctatccaga tgagctgaac
    1101  tttgtttact ctttcgggga agatttcaag aattttggga tgagagatga
    1151  ctttgacgtg tcagttctcc aatgggttaa agacaaattt tgtcaagtta
    1201  tgcctcactt cattgctgct agtttctttg agccaacaga gtttcacctc
    1251  aacatgcgaa aattattaaa tgacctggcc actaagggga tagaggttcc
    1301  actatccgtc attatcgtag acaatgtcaa ttttattgaa accaggttcc
    1351  atgccaggat gtttgacatc gcgcaggcta ttggggttaa cttgaactta
    1401  cttgggcgca gatttgacta cgacactgaa agtgaggaat atttttcaga
    1451  aaatggctat gtcttaatgc cttctaaatc gaatccagac aggaattgga
    1501  ttctgaactc tggctcttta aagattgact actctagatt gatcaaggcc
    1551  aggagattca gattgaggag agattttctg gatctcatat ctagaggtga
    1601  tgctcccagg aggcaactct tcttagaatc aaccagtgac cccaagtcaa
    1651  atcctgaggt ccccgagagt gatgcaactg gagaggcagg attatcagtg
    1701  aatgacgaga gctgccagtc gccaaaggag ttttgtgcgc caatgtccac
    1751  agaggacggc caacctttcg aaggctcaat cccgattgat ttaatcaatt
    1801  gctttgaacc ggaagaagtt aaatgcccaa gaaggaagag gaagaatgat
    1851  tgcgttttta gggctatttc tgcacacttg ggaattgaaa cccaagactt
    1901  gttgaatttc ctcgttaatg aggacatatc tgaagaacta ttggactgca
    1951  ttgatgaaga caaagggctc tcacatgaaa tgattgaaga agtattaatc
    2001  acgaaaggtc tttcaatggt ttatacttca gactttaaag agatggcagt
    2051  ccttaacaga aaatatggtg tgaatggtaa aatgtactgc accattaaag
    2101  gcaaccactg tgaattgagc tcaaaagaat gttttgtcag actgttaaag
    2151  gaaggtggtg aagctcaaat gtcaaatgag aacttgaatg ccgactccat
    2201  gtttgacctt gggaaatttg tgcataacag ggagagagcc gttaaattgg
    2251  caaaatcaat ggcgaggggt accacaggtc ttttgagttc ctttgatccg
    2301  gccttctgca agagcatggt cactctttca gagttgtttc ctgagaactt
    2351  ttcatctact gttgggctaa gattgggatt tgctggttca ggaaagaccc
    2401  acaaagtgct ccaatggatc aactacacac caagtgtcaa aagaatgttc
    2451  ataagtccaa gaaggatgct agctgatgaa gttgaggtcc agcttaaagg
    2501  gacagcctgt caagtgcaca cttgggagac cgctttgaag aagattgatg
    2551  gaaccttcat ggaggttttt attgatgaaa taggtttgta cccacctgga
    2601  tacctcacat tgttacaaat gtgtgctttt aggaagattg tcaaaggaca
    2651  gagtgagagg atcttgaaag gtaaactcag tgaactgtca aaaacttgtc
    2701  tgaacatgag gtgttttggt gacccattac aattgagata ctactctgct
    2751  gaggacacaa atcttctgga caaaacacat gagctcgaca ttttgactaa
    2801  gacaatcaag cacaaatacc ttcttcaggg gtacagattt ggccaatggt
    2851  ttcaagaact cataaacatg ccaaccaggg tggatgactc aaagttctca
    2901  agaaagttct ttgcggacat ctccagtgtc aagactgaag attacgggct
    2951  cattcttgtt gccaaaaggg aggacaaagg cgtttttgct gggaggatcc
    3001  cagtggccac agttagcgag tctcaaggga tgacaataag caaaagagta
    3051  ttgatatgtc tggatcaaaa cctctttgct ggaggggcca atgctgccat
    3101  tgttgcaatc acaaggtcga aagttgggtt tgactttatc ctcaagggga
    3151  actcactgaa ggaagtgcag aagatggccc aaaaaaccat ttggcaattc
    3201  gtcattgagg gcaaatctat cccaatggag agaatagtca acatgaatcc
    3251  tggagccagc ttctatgaaa gccccttaga cgttggaaat tcgtctattc
    3301  aagacaaagc ttctcatgat ttgtttataa tgccttttat aaatttggct
    3351  gaggaagagg ttgacccaga ggaagttctt ggggacgtga tacagcctgt
    3401  tgaatggttt aaatgccaca tacctgtctt tgatagagat ccaatgctag
    3451  cagagatatt cgataaagta gccgcaaaag aaaagagaga ggtttcatct
    3501  atattgggtc tctcaaatca atttttggac atggaaaaaa acgggtgcaa
    3551  aattgacata cttccttttg ctaggcaaaa tgtttttcca catcatcagt
    3601  cctcagatga tgttactttt tgggcaggtg ttcaaaagag gataaggaag
    3651  tccaattgga ggcgtgaaaa aacaaaattt gaagaatttg agagtcaggg
    3701  gaaagaactg ctccaagagt ttatctcgat gttgcccttt gaattcaagg
    3751  ttaacattaa agacattgaa gatggagaaa aaagcttcct agaaaaaagg
    3801  aaattgaagt cagaaaaaat gtgggcgaat cattcagaaa ggtctgacat
    3851  cgactggaag cttgaccatg ccttcctctt tatgaaatca cagtattgca
    3901  cgaaggaagg gaagatgttc accgaggcga aagccggcca aactttggcc
    3951  tgcttccaac atattgtctt gttcagattc ggacccatgc tcagagcaat
    4001  tgagagcgcc tttttaagga gctgtgggga ttcatactac atacactccg
    4051  gaaaaaactt tttctgtctg gacagctttg taacgagaaa tgcacatgtt
    4101  tttgatggat tctcaataga gtccgactac actgctttcg attcatccca
    4151  ggaccacgtc attttggcct tcgagatggc actattgcaa tatttgggtg
    4201  tatccaaaga atttcagctt gactatctga ggttgaagtt aactcttggt
    4251  tgtcgacttg ggtcattagc aataatgaga ttcaccgggg aattttgcac
    4301  ctttctgttc aacacatttg ccaacatgct tttcactcag ttgaagtaca
    4351  aaatagaccc acggaaacat aggatcttat tcgcagggga tgacatgtgc
    4401  tccctgagct ctctcaagag gagaagagga gaaagagcaa caaggttgat
    4451  gggaagcttt tccctaactg cggtggagga agtgaggaaa ttccctatgt
    4501  tctgtggatg gtatttgagt ccatatggaa tcatcaaatc tccaaaattg
    4551  ttatgggcca ggattaagat gatgagtgaa agacagctcc tgaaagaatg
    4601  cgttgacaac tatctgtttg aggcaatatt tgcctacagg ttaggtgaga
    4651  ggctgtacac aattttgaaa gaagaagact tcgaatatca ttatcttgtt
    4701  ataagattct ttgtcaggaa ttcgaagcta ctaacgggtt taagtaagag
    4751  cttgattttc gaaattggag aaggaattgg gtctgaatgg cgatcgtcaa
    4801  tgtcaaccat ttcctcaagg aggtcgagtc aacagacctc aagattgacg
    4851  caatctcatc ctcagaactt tacaaagatg caaccttttt caagccggat
    4901  gtgctcaatt gtatcaaaag atttgagtca aatgtcaaag tttcctccag
    4951  gtctggggat ggactggtct tgtcagattt caagttgctt gatgacactg
    5001  aaatcgactc aatcagaaaa aagagcaaca agtacaagta cttgcattac
    5051  ggagtcattc tggttggaat caaagcaatg ctgccaaact tcagaggtat
    5101  ggaaggaagg gtcattgtgt atgacggagc ctgtcttgat ccggaaaaag
    5151  gccatatatg ctcgtatttg tttaagtttg agtctgactg ctgttacttc
    5201  ggtcttagac ctgaacactg cttatccacc acagatgcca acctggcgaa
    5251  gagattcaga tttcgtgtgg actttcactg cccacagtat gaacaggaca
    5301  ctgagttgtt tgctcttgac attggtgtgg cctacagatg tgttaattca
    5351  gcccgcttct tggaaaccaa gactggagac tcagggtggg cctcgcaggc
    5401  tattagtggc tgtgaggcac tcagatttaa tgaagaaatt aaaatggcaa
    5451  ttttggacca taagtctcca ttatttctgg aggaaggtgt tccaaatgtt
    5501  catattgaaa agaggctgtt cagaggtgac aagattagaa ggtcacgctc
    5551  gatttctgca aaaagggggc caaactcgaa accgcaggaa aagagaggat
    5601  ttaggtccct ctcagctaga attgaaagat tcggagaaaa tgagtttgga
    5651  agacgtgctt caacaagcga ggcgccaccg ggtaggagtg tatctttgga
    5701  agacacatat agacccggca aaggaacttc tgacggttcc tccccctgaa
    5751  gggtttaagg aaggtgaaag ctttgaaggc aaggagcttt accttcttct
    5801  ttgcaaccat tattgtaaat acttatttgg taatattgct gttttcgggt
    5851  catctgataa gacccagttc cctgctgttg gatttgatac ccctccggtt
    5901  cattacaatt tgacaacgac cccaaaagaa ggggaaactg aagagcaaaa
    5951  gaaggccaga gagggttcgt ctggcgaaaa aacaaaaatt tggagaatcg
    6001  acttgtcaaa tgttgtacct gaattgaaaa cctttgctgc cacttctagg
    6051  cagaactctt tgaatgaatg tacattcaga aagctttgtg agccattcgc
    6101  tgatttggcc cgtgagtttc ttcatgaaag gtggtcaaaa ggattggcca
    6151  ctaacattta taagaaatgg cccaaagctt ttgaaaaaag cccttgggtg
    6201  gcatttgatt ttgccaccgg tctaaaaatg aatcgtttaa cacctgatga
    6251  gaaacaggtg atcgacagga tgaccaaaag gctttttcgt actgaaggac
    6301  aaaaaggggt tttcgaggca ggttcggaga gtaatctgga actggagggt
    6351  taggagtcgt gtgaaattcc gcaaatttgg tcgcggtctt gcaggttgac
    6401  atgcctgcct ttatacttaa ataaagggtt cacccggttt tctgtgcatt
    6451  tccgggttag tgtggttttt ctagagtcta gagtttgtcc actcta