!!NA_SEQUENCE 1.0
ID   BNY26KDAP  standard; RNA; VRL; 1347 BP.
XX
AC   D63759;
XX
SV   D63759.1
XX
DT   19-AUG-1995 (Rel. 44, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 6)
XX
DE   Beet necrotic yellow vein virus gene for 26kDa protein, complete cds.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1347
RA   Kiguchi T.;
RT   ;
RL   Submitted (31-JUL-1995) to the EMBL/GenBank/DDBJ databases.
RL   Tadahiko Kiguchi, Hokkaido Central Agricultural Experiment Station, Plant
RL   Biotechnology; Higashi 6 Kita 15, Naganuma, Hokkaido 069-13, Japan
RL   (Tel:81-1238-9-2001, Fax:81-1238-9-2060)
XX
RN   [2]
RX   MEDLINE; 96203943.
RX   PUBMED; 8627244.
RA   Kiguchi T., Saito M., Tamada T.;
RT   "Nucleotide sequence analysis of RNA-5 of five isolates of beet necrotic
RT   yellow vein virus and the identity of a deletion mutant";
RL   J. Gen. Virol. 77:575-580(1996).
XX
DR   SPTREMBL; Q65681; Q65681.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1347
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /strain="D-5"
FT                   /clone="pMSD514"
FT   CDS             449. .1135
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q65681"
FT                   /note="putative"
FT                   /product="26kDa protein"
FT                   /protein_id="BAA09840.1"
FT                   /translation="MDIDHCMPVFDMAYSDDNHLPYYIQRSTHHVVRDVDYTGFICYPL
FT                   QVDLNDNVEVGADIYHMKIKTMRFNVDIYNNDVATNFPGWVRFIVFCTPPVSSWVNDGC
FT                   SSLFSPFVGVNSFIDPKLLKRDGHGITVLHDGIYCLCYQEHFTRSFEFNFRGPGNYTLT
FT                   NDVCWSPATNVDSIYVACVASWCGDSAFMLQSDSVSWVHKRFWQRPVLEFGQCLDDLPD
FT                   HDNDCG"
XX
SQ   Sequence 1347 BP; 357 A; 207 C; 297 G; 486 T; 0 other;

  D63759  Length: 1347  July 15, 2003 09:23  Type: N  Check: 7200  ..
       1  aaattcaaag tactttcata ttgtacttat tagtaccgct gttctaagtg
      51  acgtaagtgg ggtgtaggcc cggggagctg gatgcagtaa tttatcgatg
     101  taccttttcg actacctcaa tttgaaaacg agtgtaaagt aaaagggagg
     151  ttactaaaca aaatagccct ccatacggta cgatttataa tcatatttat
     201  atgcccactt ggtgtcactc agaagcagtg tttgtgaaaa tttgtgcgtg
     251  agccttgtgc cgcacttgcg tgagcctttg gccgcttttc ctttgcgatt
     301  gtactttgtt tttccgctcg cacaagcgtt aaagtactag ttacagtgca
     351  taaaacaaaa taaaaataaa ataaataact taaattatta atagtaattt
     401  gcaatttgta agttacgact ataattataa ttataattac aatttgtgat
     451  ggatattgat cattgtatgc ctgtatttga tatggcatat agcgacgata
     501  atcacctccc ttattacata cagagatcga ctcatcatgt ggttcgggat
     551  gttgattata ctggttttat atgttatcct ttgcaggttg atcttaatga
     601  taatgttgag gttggtgctg atatttatca catgaagatt aagactatga
     651  gatttaatgt tgatatttat aacaacgatg ttgccacaaa tttcccaggt
     701  tgggttaggt ttattgtgtt ttgtacacct cctgtgtctt cttgggttaa
     751  tgacgggtgc tctagtctgt tttcaccttt tgtaggtgtg aatagtttta
     801  ttgatcctaa attgttaaaa cgtgatggtc atgggattac tgtgttacat
     851  gatggtattt attgcttgtg ctatcaagaa cattttacca gaagttttga
     901  gtttaacttt cgtggacctg gtaattatac cctaactaat gatgtttgtt
     951  ggtcccccgc tactaatgta gattctatat atgtggcttg tgttgctagt
    1001  tggtgtggtg atagtgcttt catgttgcag tccgatagtg tgtcttgggt
    1051  acacaagaga ttttggcaac gacctgtgtt ggaatttggg caatgtttgg
    1101  atgatctacc agatcatgat aatgattgtg gatgatcgtt tgtgacgtcc
    1151  gaagacgtta aactacccgc atatgcggtg tttacgggct cgtttacaag
    1201  cctccttgct atggtaaggt ttatgtaaac acaaaaatat ggcttattgg
    1251  ttatgctaaa cctcatatgt tattgaataa ggttgggatg tactgactgg
    1301  atgtgaaatg tgccagtctt tatagggttc tctgtcagtg tattgac