!!NA_SEQUENCE 1.0
ID   BNY26KDA1  standard; RNA; VRL; 1320 BP.
XX
AC   D63935;
XX
SV   D63935.1
XX
DT   04-OCT-1995 (Rel. 45, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 6)
XX
DE   Beet necrotic yellow vein virus gene for 26kDa protein, complete cds.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1320
RA   Kiguchi T.;
RT   ;
RL   Submitted (28-AUG-1995) to the EMBL/GenBank/DDBJ databases.
RL   Tadahiko Kiguchi, Hokkaido Central Agricultural Experiment Station, Plant
RL   Biotechnology; Higashi 6 Kita 15, Naganuma, Hokkaido 069-13, Japan
RL   (Tel:81-1238-9-2001, Fax:81-1238-9-2060)
XX
RN   [2]
RX   MEDLINE; 96203943.
RX   PUBMED; 8627244.
RA   Kiguchi T., Saito M., Tamada T.;
RT   "Nucleotide sequence analysis of RNA-5 of five isolates of beet necrotic
RT   yellow vein virus and the identity of a deletion mutant";
RL   J. Gen. Virol. 77:575-580(1996).
XX
DR   SPTREMBL; Q65680; Q65680.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1320
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /isolate="SH1"
FT                   /clone="pMSH117"
FT   5'UTR           <1. .421
FT   CDS             422. .1108
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q65680"
FT                   /product="26kDa protein"
FT                   /protein_id="BAA09968.1"
FT                   /translation="MDIDHCMPVFDMAYSDDNHLPYYIQRSTHHVVRDVDYTGFICYPL
FT                   QVDLNDNVEVGADIYHMKIKTMRFNVDIYNNDVATNFPGWVRFIVFCTPPVSSWVNDGC
FT                   SSLFSPFVGVNSFIDPKLLKRDGHGVTVLHDGIYCLCYQEHFTRSFEFNFRGPGNYTLT
FT                   NDVCWSPATNVDSIYVACVASWCGDSAFMLQSDSVSWVHKRFWQRPVLEFGQCLDDLPD
FT                   HDNDCG"
XX
SQ   Sequence 1320 BP; 346 A; 202 C; 295 G; 477 T; 0 other;

  D63935  Length: 1320  July 15, 2003 09:23  Type: N  Check: 7080  ..
       1  tattagtacc gctgttctaa gtgacgtaag tggggtgtag gcccggggag
      51  ctggatgcag taatttatcg atgtaccttt tcgactacct caatttgaaa
     101  acgagtgtaa agtaaaaggg aggttactaa acaaaatagc cctccatacg
     151  gtacgattta taatcatatt tatatgccca cttggtgtca ctcagaagca
     201  gtgtttgtga aaatttgtgc gtgagccttg tgccgcactt gcgtgagcct
     251  ttggccgctt ttcctttgcg attgtacttt gtttttccgc tcgcacaagc
     301  gttaaagtac tagttacagt gcttaaaata aaataaaaat aaaataaata
     351  acttaaatta ttaatagtaa tttgcaattt gtaagttacg actataatta
     401  taattataat tacaatttgt gatggatatt gatcattgta tgcctgtatt
     451  tgatatggca tatagcgacg ataatcacct cccttattac atacagagat
     501  cgactcatca tgtggttcgg gatgttgatt atactggttt tatatgttat
     551  cctttgcagg ttgatcttaa tgataatgtt gaggttggtg ctgatattta
     601  tcacatgaag attaagacta tgagatttaa tgttgatatt tataacaacg
     651  atgttgccac aaatttccca ggttgggtta ggtttattgt gttttgtaca
     701  cctcctgtgt cttcttgggt taatgacggg tgctctagtc tgttttcacc
     751  ttttgtaggt gtgaatagtt ttattgatcc taaattgtta aaacgtgatg
     801  gtcatggggt tactgtgtta catgatggta tttattgctt gtgctatcaa
     851  gaacatttta ccagaagttt tgagtttaac tttcgtggac ctggtaatta
     901  taccctaact aatgatgttt gttggtcccc cgctactaat gtagattcta
     951  tatatgtggc ttgtgttgct agttggtgtg gtgatagtgc tttcatgttg
    1001  cagtccgata gtgtgtcttg ggtacacaag agattttggc aacgacctgt
    1051  gttggaattt gggcaatgtt tggatgatct accagatcat gataatgatt
    1101  gtggatgatc gtttgtgacg tccgaagacg ttaaactacc cgcatatgcg
    1151  gtgtttacgg gctcgtttac aagcctcctt gctatggtaa ggtttatgta
    1201  aacacaaaaa tatggcttat tggttatgct aaacctcata tgttattaaa
    1251  taaggttggg atgtactgac tggatgtgaa atgtgccagt ctttataggg
    1301  ttctctgtca gtgtattgac