!!NA_SEQUENCE 1.0
ID   BND26KDA1  standard; RNA; VRL; 1259 BP.
XX
AC   D63937;
XX
SV   D63937.1
XX
DT   01-NOV-1996 (Rel. 49, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 4)
XX
DE   Beet necrotic yellow vein virus RNA for 26kDa protein, complete cds.
XX
KW   26kDa protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1259
RA   Kiguchi T.;
RT   ;
RL   Submitted (28-AUG-1995) to the EMBL/GenBank/DDBJ databases.
RL   Tadahiko Kiguchi, Hokkaido Central Agricultural Experiment Station, Plant
RL   Biotechnology; Higashi 6 Kita 15, Naganuma, Hokkaido 069-13, Japan
RL   (Tel:01238-9-2001, Fax:01238-9-2060)
XX
RN   [2]
RP   1-1259
RA   Kiguchi T., Saito M., Tamada T.;
RT   "The nucleotide sequence of beet necrotic yellow vein virus RNA-5";
RL   Unpublished.
XX
RN   [3]
RX   MEDLINE; 96203943.
RX   PUBMED; 8627244.
RA   Kiguchi T., Saito M., Tamada T.;
RT   "Nucleotide sequence analysis of RNA-5 of five isolates of beet necrotic
RT   yellow vein virus and the identity of a deletion mutant";
RL   J. Gen. Virol. 77:575-580(1996).
XX
DR   SPTREMBL; Q96638; Q96638.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1259
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /organism="Beet necrotic yellow vein virus"
FT   5'UTR           <1. .360
FT   CDS             361. .1047
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q96638"
FT                   /product="26kDa protein"
FT                   /protein_id="BAA09970.1"
FT                   /translation="MDIDHCMPVFDMAYSDDNHLPYYIQRSTHHVVRDVDYTGFICYPL
FT                   QVDLNDNVEVGADIYHMKIKTMRFNVDIYNNDVATKFPGWVRFIVFCTPPVSSWVNDGC
FT                   SSLFSPFVGVNSFIDPKLLKRDGHGITVLHDGIYCLCYQEHFTRSFEFNFRGPGNYTLT
FT                   NDVCWSPATNVDSIYVACVASWCGDSAFMLQSDSVSWVHRRFWQRPVLEFGQCLDDLPD
FT                   HDNDCG"
XX
SQ   Sequence 1259 BP; 331 A; 195 C; 275 G; 458 T; 0 other;

  D63937  Length: 1259  July 15, 2003 09:23  Type: N  Check: 6176  ..
       1  gcagtaattt atcgatgtac cttttcgact acctcaattt gaaaacgagt
      51  gtaaagtaaa agggaggtta ctaaacaaaa tagccctcca tacggtacga
     101  ttcataatca tatttatatg cccacttggt gtcactcaga agcagtgttt
     151  gtgaaaaatt tgtgcgtgag ccttgtgccg cacttgcgtg agcctttggc
     201  cgcttttcct ttgcgattgt actttgtttt tccgctcgca caagcgttaa
     251  agtactagtt acggtgctta aaataaaata aaataaataa cttaaattat
     301  taatagtaat ttgcaatttg taagttacga ctataattat aattataatt
     351  acaatttgtg atggatattg atcattgtat gcctgtattt gatatggcat
     401  atagcgacga taatcacctc ccttattaca tacagagatc gactcatcat
     451  gtggttcggg atgttgatta tactggtttt atatgttatc ctttgcaggt
     501  tgatcttaat gataatgttg aggttggtgc tgatatttat cacatgaaga
     551  ttaagactat gagatttaat gttgatattt ataacaacga tgttgccaca
     601  aagttcccag gttgggttag gtttattgtg ttttgtacac ctcctgtgtc
     651  ttcttgggtt aatgatgggt gctctagtct gttttcacct tttgtaggtg
     701  tgaatagttt tattgatccc aaattgttaa aacgtgatgg tcatgggatt
     751  actgtgttac atgatggtat ttattgcttg tgctatcaag aacactttac
     801  cagaagtttt gagtttaact ttcgtggacc tggtaattat accctaacta
     851  atgatgtttg ttggtccccc gctactaatg tagattctat atatgtggct
     901  tgtgttgcta gttggtgtgg tgatagtgct ttcatgttgc agtccgatag
     951  tgtgtcttgg gtacacagga gattttggca acgacctgtg ttggaatttg
    1001  ggcaatgttt ggatgatcta ccagatcatg ataatgattg tggatgatcg
    1051  tttgtgacgt ccgaagacgt taaactaccc gcatatgcgg tgtttacggg
    1101  ctcgtttaca agcctccttg ctatggtaag gtttatgtaa acacaaaaat
    1151  atggcttatt ggttatgcta aacctcatat gttattaaat aaggttggga
    1201  tgtactgact ggatgtgaaa tgtgccagtc tttatagggt tctctgtcag
    1251  tatattgac