!!NA_SEQUENCE 1.0
ID   BN237LP1   standard; RNA; VRL; 6746 BP.
XX
AC   D84410;
XX
SV   D84410.1
XX
DT   09-MAY-1996 (Rel. 47, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 6)
XX
DE   Beet necrotic yellow vein virus genomic RNA for 237k protein, complete cds.
XX
KW   237k protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-6746
RA   Kiguchi T.;
RT   ;
RL   Submitted (12-APR-1996) to the EMBL/GenBank/DDBJ databases.
RL   Tadahiko Kiguchi, Hokkaido Central Agricultural Experiment Station, Plant
RL   Biotechnology; Higashi 6 Kita 15, Naganuma, Hokkaido 069-13, Japan
RL   (Tel:01238-9-2001, Fax:01238-9-2060)
XX
RN   [2]
RP   1-6746
RA   Saito M., Kiguchi T., Kusume T., Tamada T.;
RT   "Complete nucleotide sequence of a Japanese isolate S of beet necrotic
RT   yellow vein virus and comparison with European isolates";
RL   Unpublished.
XX
RN   [3]
RA   Saito M., Kiguchi T., Kusume T., Tamada T.;
RT   "Complete nucleotide sequence of the Japanese isolate S of beet necrotic
RT   yellow vein virus and comparison with European isolates";
RL   Arch. Virol. 141:2163-2175(1996).
XX
DR   GOA; Q65667.
DR   SPTREMBL; Q65667; Q65667.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .6746
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /clone="pMSD[8 and 49], pMSC[10 and 26], p1F[61-2, 61-8,
FT                   1645-10 and 1645-18]"
FT                   /isolate="S"
FT                   /lab_host="Tetragonia expansa"
FT   5'UTR           1. .153
FT   CDS             154. .6483
FT                   /db_xref="GOA:Q65667"
FT                   /db_xref="SPTREMBL:Q65667"
FT                   /product="237k protein"
FT                   /protein_id="BAA12339.1"
FT                   /translation="MADSFGFTPMEVLLFGGESVQLLTSDMPIDVQWGFVHSTRCYALW
FT                   KDDLIHLNPLLKYSQRIAKRWERLVSGFVGPVPLDKLLSLLAKLMRYCVNMGVSVQEIY
FT                   LSDAIVSSSYMLHVSRSAGCVSFSWLYAKLSMFASCGKFWVGSSHHTAANMIEGSRAVN
FT                   GPDVAISEMVEAFHLEVKSSLVVTVSLTPREKKILERELGFVPLYKQKSRAPRNHPVLA
FT                   ALREVMRQEYSASCNILNTKLKTLVVGAASREVNCYSSNPSVHYYFANKDSKDLVRTTL
FT                   ELLHSALATKYRNMESGERELMNNLKGCGYIVKRSVENAVYEVVSDKDVAEVLRYAQTV
FT                   ASTKKEAKKKPNTGKRKMVMSEATRRTIELHELSRIVAEEKKIPNHFHFDESDFASVGN
FT                   FTQLVCEDVGYNFSVDAWLHLFEATGAQTAVGYMALPNELLFEHYPISDYYDYWEGVEK
FT                   HGSLGGITISPLRNGQVVGMPTGVFQPVHFDKTSAGLGIPGSKMGAAERVICHMSDGLG
FT                   NGYNHVKSDWQTLLKHPILSSSKYNFAVEVDLTGRYGCLATFRLTRVTGVKYVARTIKL
FT                   RPEDRYVRVLDLLHIVRSIRLKGHAGLKEPYQYFPVYKREVDTPVSYCFSIAEKSLTVQ
FT                   NIANFIRHHIGGVSLVNKELVSAWRLNPQLVPSFAYAVYFYVVNLRGELDGMLQKLMKK
FT                   GITWADRLKANVSAFLRDMVDPISFLWTWLFERRLVDQIFQDGTDVFYQMDRACVDEKA
FT                   LRLNDHIKITRDFLPADTLLPEGWSLDDWEKAPDSLKTLSAAASLPVECGAVNCVGKSF
FT                   KSVRTLLPPSVVTSPVEQFFKSGGKFRDDAEFAELLSAHYRWQMDNSFCACQVCAALTG
FT                   KTGSQVVECRWKAESMYTFSMSQTEVDDFRNEIKAQSIEKGNRFGEMLIGVHQKIPTQA
FT                   FEVSVRLEYVKGGPGTGKSFLIRSLADPIRDLVVAPFIKLRSDYQNQRVGDELLSWDFH
FT                   TPHKALDVTGKQIIFVDEFTAYDWRLLAVLAYRNHAHTIYLVGDEQQTGIQEGRGEGIS
FT                   ILNKVDLSKVSTHVPIMNFRNPVRDVKVLNYLFGSRMVPMSSVEKGFSFGDVKEFSSLS
FT                   NIPDTKIIHYSDETGEHMMPDYVRGVSKTTVRANQGSTYDNVVLPVLPSDLNLINSAEL
FT                   NLVALSRHRNKLTILLDNDGMNIGAVLKGMLEGVPEELERRDYIVGMYLGLHLPIKKEF
FT                   FFPESEFAKSFRLMVAKYEAFVPYDSNLPTLVLQGDVVVLDIARVENDINDAFNCPDFY
FT                   NLVSRPNNCLVVAISECLGVTLEKLDNLMQANAVTLDKYHAWLSKKSPSTWQDCRMFAD
FT                   ALKVSMYVKVLSDKPYDLTYEVDGAGSSVTLHLVGKESDGHFIAAPLSPSLSTNERESG
FT                   HDSKKPADDSDTFDAANLFADKGVSSADIEAFCAYLEKTLMATIMEYDLRLQSWANVVD
FT                   DTDDFYQINISEFRQSTCFGKLLSALEVLKVDVSRKRFISDWLCKNLENKQFRWRWSSS
FT                   VASTSSAGSNVDDDFVNMAGGKTDANVDPADVLRQSFMDYASEFVPILIAESPILMPLV
FT                   EPEPILSKCMVPEFDAFLLIKEFDLDNGADEYQCAYLNESVANRVGDKFVSGVLDTDII
FT                   SPLNLRGHPIAENVKYHSMCVAPAQIYFKRNQWQELQVQQARYLFRKVRNSPSSTQDSV
FT                   ARMVAQLFVSDCLVPNVADTFSASNLWRIMDKAMHDMVTKNYQGQMEEEFTRNAKLYRF
FT                   QLKDIEKPLKDPETDLAKAGQGILAWSKEAHVKFMVAFRVLNDLLLKSLNSNVVYDNTM
FT                   SETEFVGKINAAMNIVPDSAINGVIDAAACDSGQGVFTQLIERHIYAALGISDFFLDWY
FT                   FSFREKYVMQSRYVRAHMSYVKTSGEPGTLLGNTILMGAMLNAMLRGTGPFCMAMKGDD
FT                   GFKRQANLKINDQMLKLIKKETVLDFKLDLNVPITFCGYALSNGHLFPSVSRKLTKIAA
FT                   HRFREYKHFCEYQESLRDWIKNLPKDPAVYADFLECNASLSCRNVDDVQRWLDAIISVS
FT                   RIGREQFMMMFPIREVFMSLPPVEDSLGELSSTKVAVSIGDNVSNVVRKVARVDMKKF"
XX
SQ   Sequence 6746 BP; 1735 A; 1045 C; 1649 G; 2317 T; 0 other;

  D84410  Length: 6746  July 15, 2003 09:17  Type: N  Check: 8224  ..
       1  aaattcgatt cttcccattc gccatcattg aatcattact cgtgtactgg
      51  aacgcagtta ggagtggctc caaagcatct tctttgaaaa tagattgcga
     101  agtgagttca cctaagacga cgtcggtgtt ttacgagttt ttacataatc
     151  aacatggcag attcgttcgg ttttactcca atggaggttt tgctttttgg
     201  tggtgaatcg gttcagttgt taacttcaga catgcctatt gatgtccagt
     251  ggggctttgt acactccact cgatgttatg ctctctggaa agacgacttg
     301  attcatctca atccgctgtt gaaatattca cagcgaattg caaaacggtg
     351  ggaaaggtta gtttcgggct ttgttggccc agtaccgctt gataagttgt
     401  tgtctttgtt ggcaaaactt atgaggtatt gtgttaacat gggggtgtct
     451  gtacaggaga tatatttgtc tgatgctatt gtttcatcgt cttatatgtt
     501  gcatgtgtct aggagtgcag gttgtgtgtc ttttagttgg ttgtatgcca
     551  agctgtccat gtttgcttcg tgtggcaagt tctgggtagg gtcttcacat
     601  cacacggctg ccaacatgat tgaaggttcc cgtgctgtga atggtccgga
     651  tgtggctatt tctgagatgg ttgaagcctt ccatttagag gtgaagtctt
     701  cactcgttgt aactgtgtct ttgactccta gggagaaaaa gattctggag
     751  cgagagctag gttttgtgcc gttgtacaaa cagaaaagta gagctccacg
     801  caatcaccca gtgctggctg ctcttcgcga ggttatgagg caggagtatt
     851  ctgctagttg taatattctt aatacaaagt tgaaaacact ggtagttggt
     901  gctgccagtc gtgaagttaa ttgttattcg tctaatccgt ctgtacatta
     951  ctattttgct aataaagata gcaaggattt ggtaaggacc actctggagt
    1001  tgttgcatag cgctttggct acaaagtacc gcaatatgga aagtggtgag
    1051  cgagaactca tgaataattt gaagggttgt ggttatattg tcaaaaggtc
    1101  ggttgaaaat gctgtctatg aggttgtttc tgataaagat gttgccgaag
    1151  tgttaaggta tgcgcaaact gtcgcttcaa cgaagaaaga ggcgaaaaag
    1201  aaacctaaca ctggaaagcg aaaaatggtc atgtcggaag caactcgtag
    1251  aacaatcgaa ctgcatgagt tgtcgcgtat tgtagccgaa gagaagaaga
    1301  ttcctaacca tttccacttt gatgaaagtg attttgcttc tgttggtaat
    1351  tttactcagt tggtttgtga agatgttggt tacaattttt ctgtggatgc
    1401  ttggttgcat ttgttcgagg cgaccggtgc gcagactgcc gttggttata
    1451  tggcattgcc taacgaactt ttgtttgaac attatccaat atcagattat
    1501  tatgattatt gggagggtgt tgaaaagcat ggttcattgg gtggtattac
    1551  tatttcccct ttgcggaatg gacaggttgt tggtatgccg actggggttt
    1601  ttcaacctgt tcattttgac aagacgtctg ctggtttagg tattcctggt
    1651  tcaaagatgg gtgctgctga acgtgttata tgtcacatgt cagatggact
    1701  tggaaatggc tacaatcatg ttaaaagtga ttggcagacg ttgttgaaac
    1751  atcctatttt gtcttcttca aagtataatt ttgctgttga agtggattta
    1801  acgggacgtt atggttgtct tgctaccttt cggttaactc gtgtgactgg
    1851  agtcaagtat gttgctagaa ctataaaatt gcgtccagaa gataggtatg
    1901  ttcgggtgtt ggatttgtta catattgtgc gtagtattag gttgaaaggg
    1951  catgccggtt tgaaagaacc atatcagtat tttcctgtgt ataaacgtga
    2001  ggtagatacg ccggtgtctt actgtttttc tattgctgaa aaatcgttga
    2051  cagtacaaaa cattgctaat tttattagac atcatattgg tggtgtttct
    2101  ttagttaaca aagaattagt atcggcgtgg cgtctgaatc cacaacttgt
    2151  tccttcgttc gcatatgccg tttactttta tgttgttaat ttgagaggtg
    2201  agttggatgg gatgttgcag aagttaatga aaaagggtat cacatgggca
    2251  gataggttga aggctaatgt ttcagcgttt ttgcgagata tggtagatcc
    2301  tattagtttt ttgtggacgt ggttatttga gaggagatta gtcgatcaaa
    2351  tttttcagga tgggactgat gttttttacc agatggatcg tgcttgtgtt
    2401  gatgagaagg cattgcgttt gaacgatcac attaaaatca cacgagactt
    2451  tttgcctgct gacactttac ttcctgaagg atggtcttta gacgattggg
    2501  aaaaagctcc cgatagtttg aagactcttt cggcagctgc ttcgttgcca
    2551  gtagagtgcg gggcggtaaa ttgtgttggt aagtcgttta agagcgtgcg
    2601  tactctatta ccaccatctg ttgttacttc acctgttgag cagtttttca
    2651  aatctggtgg taaatttaga gatgatgccg agtttgcgga attgttgagt
    2701  gcgcactatc gctggcagat ggacaattct ttttgtgctt gtcaggtttg
    2751  tgctgctttg actggtaaaa cgggttctca agttgttgaa tgcagatgga
    2801  aagctgagtc tatgtataca ttttctatgt cacaaactga ggttgatgat
    2851  tttagaaatg agattaaggc tcaatctatt gaaaagggaa atcgttttgg
    2901  tgaaatgtta ataggtgtac atcagaaaat tcctacacaa gcctttgagg
    2951  tttcagttcg actcgaatat gttaaaggtg ggcctggtac gggtaaatct
    3001  tttcttataa gatcattggc tgaccctatc agggatcttg tggttgctcc
    3051  gttcataaaa ttgcgttctg attatcagaa tcaacgagtt ggtgatgagc
    3101  ttctttcttg ggactttcac acgcctcaca aagcattgga tgttactggt
    3151  aagcaaatta tttttgttga tgagtttaca gcctatgatt ggcgtttact
    3201  agctgtgttg gcttatagaa atcatgccca tactatttac ttagttggtg
    3251  atgagcagca gactggtatt caagagggtc gtggagaagg aatatcgata
    3301  cttaacaaag ttgatctgtc taaggtttct acacatgttc caatcatgaa
    3351  ctttagaaat cctgtccgtg atgttaaggt attaaattat ctgtttgggt
    3401  ctcgtatggt tcctatgtct tccgttgaaa agggatttag tttcggggat
    3451  gttaaagaat tttcgtcttt gtcaaatatc ccagacacta aaatcattca
    3501  ttattccgat gagactggtg aacatatgat gcctgattac gttaggggag
    3551  tgtcaaaaac tactgtccgt gctaatcagg gtagtaccta cgataatgtt
    3601  gttttgcctg ttttaccatc tgatttgaac ctgattaact cagctgagtt
    3651  gaatttggta gctttatctc gtcacaggaa taagttaacc attttattgg
    3701  acaatgatgg tatgaatatt ggtgctgttt tgaaaggcat gcttgagggt
    3751  gtgccggaag aactcgaaag aagggattac attgttggga tgtaccttgg
    3801  gttacattta cctattaaga aagagttctt ctttcctgag tctgagtttg
    3851  ctaaatcgtt tagattaatg gttgctaagt atgaggcatt tgtaccttac
    3901  gatagtaatt tgccaacttt ggttttacaa ggagatgtcg ttgttttgga
    3951  catagcacgt gtggaaaacg acattaatga tgcctttaat tgtccagatt
    4001  tctataatct tgtgtctcgt cctaacaatt gtttagtagt agctatttca
    4051  gaatgtttag gtgtgacgct agaaaaattg gacaatctta tgcaagctaa
    4101  cgctgtgacg cttgataagt atcacgcgtg gttgtctaag aagtctccat
    4151  caacttggca agactgtaga atgtttgccg atgctctgaa ggtttccatg
    4201  tacgttaagg ttttatctga caaaccttac gatctaactt atgaggttga
    4251  tggtgctggt tcctcagtga cattacattt agttggtaag gaaagcgatg
    4301  ggcattttat tgctgccccg cttagtccgt cgctttctac caatgagaga
    4351  gagtccggac atgatagtaa gaaaccggct gatgattctg acacctttga
    4401  tgctgctaat ttgtttgctg ataagggtgt ttcttccgct gatatagagg
    4451  ctttttgtgc ctatttagaa aagactttaa tggcaacaat tatggagtat
    4501  gatttgagat tgcaatcgtg ggctaatgtg gttgatgata ctgacgattt
    4551  ttatcaaatt aatatttctg agtttcgtca gtccacgtgt tttggtaaat
    4601  tgttgtcagc gcttgaagtt ttgaaggttg atgtttcgag gaagaggttt
    4651  atatctgatt ggttgtgtaa aaatcttgag aataaacaat tccggtggcg
    4701  ttggtcttct agtgtggctt caactagttc ggccgggtcg aatgtcgacg
    4751  atgattttgt caatatggca gggggaaaga ctgatgctaa tgttgatcct
    4801  gctgatgttt tgaggcagag ttttatggat tatgcatcgg aatttgttcc
    4851  tatccttatc gctgaatcac caatacttat gccgttagtt gagcctgaac
    4901  cgatattgtc caagtgtatg gtgcctgagt ttgacgcctt tttattaata
    4951  aaggaatttg atttggacaa tggtgctgat gagtatcaat gcgcttatct
    5001  taatgaatct gttgctaatc gtgttggtga caaatttgtt tcgggtgttt
    5051  tggacactga tattatatct ccattaaatc tgaggggaca tcctattgct
    5101  gaaaatgtta aatatcacag tatgtgtgtg gccccggctc agatatattt
    5151  taagcggaat cagtggcaag aattacaggt tcaacaggct cggtacttat
    5201  ttcgaaaagt gaggaattct ccatcatcga cacaagatag tgttgcacgt
    5251  atggttgctc agctatttgt ttctgattgt ttggtgccaa acgtagctga
    5301  tactttttct gcttccaatt tgtggcgaat tatggacaaa gctatgcatg
    5351  acatggtcac aaaaaattat caaggacaaa tggaagagga gtttacgcgt
    5401  aatgctaaat tatatcgttt tcagttgaag gatattgaaa aacctttgaa
    5451  ggacccagag actgatttgg caaaggctgg tcaagggata ttggcatggt
    5501  ctaaggaggc acatgttaag tttatggttg cttttagagt tttaaatgat
    5551  ttgttattga agtcgttaaa ctctaatgtt gtttacgata acacaatgtc
    5601  tgagaccgaa tttgttggaa aaataaatgc cgccatgaat atagtaccgg
    5651  atagtgctat aaacggggtt atcgatgctg ctgcttgcga ttctgggcaa
    5701  ggggttttta cccaattgat agaaagacat atttatgctg ctttgggcat
    5751  ttctgacttc tttttggatt ggtatttctc atttcgtgag aaatatgtta
    5801  tgcagtccag atatgtcaga gcacatatgt cttatgttaa gactagtgga
    5851  gaacccggca ctttgcttgg taacaccatt ttaatgggtg ctatgttaaa
    5901  tgctatgctt cgtgggaccg gaccattttg tatggccatg aagggcgatg
    5951  atggttttaa aaggcaggct aatttgaaaa ttaacgatca aatgttaaag
    6001  ttgattaaaa aggaaactgt cttggatttc aaattggatt taaatgttcc
    6051  tatcactttt tgtggttatg ctttatctaa tggacatttg tttccaagtg
    6101  tttcacgtaa attgacgaag atagcagcac acaggttccg tgagtataag
    6151  catttttgtg aataccagga atctttgcgt gattggatta aaaatcttcc
    6201  caaagaccca gctgtttatg ctgatttttt ggagtgtaat gctagcttat
    6251  cttgtcgcaa tgttgacgat gttcaacgtt ggttggatgc tattatctct
    6301  gtgtcccgaa ttgggcgtga gcaatttatg atgatgttcc cgatacggga
    6351  agtttttatg tcattgccac ccgttgagga tagtttgggt gagttatctt
    6401  ctacgaaagt ggctgtgtct attggggaca atgtttctaa tgttgttaga
    6451  aaggttgccc gtgtcgatat gaaaaagttt taatgtgtaa tatagtaata
    6501  taatacgttg tatacttgtg agtagtataa gtttgaaaat gaataaaggc
    6551  catgccacag gcctcctatc ttgatgaagg ttgttgtggt tttctcatta
    6601  ctgttttatt attgtttgag ttgcttatgt cggttcttga ttatgtggtg
    6651  cataattatt gaactaattg tttgttgggt tgtaatgtac tgactgggtg
    6701  tgaattgtac cagtcgttaa agggtttact atcagtatat tgatat