ID   BNKPRO2    standard; genomic RNA; VRL; 4609 BP.
XX
AC   D84411;
XX
SV   D84411.1
XX
DT   09-MAY-1996 (Rel. 47, Created)
DT   09-JUN-2006 (Rel. 88, Last updated, Version 9)
XX
DE   Beet necrotic yellow vein virus genes for 42k protein, 13k protein, 15k
DE   protein, 14k protein, 75k protein, complete cds.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-4609
RA   Kiguchi T.;
RT   ;
RL   Submitted (12-APR-1996) to the EMBL/GenBank/DDBJ databases.
RL   Tadahiko Kiguchi, Hokkaido Central Agricultural Experiment Station, Plant
RL   Biotechnology; Higashi 6 Kita 15, Naganuma, Hokkaido 069-13, Japan
RL   (Tel:81-1238-9-2001, Fax:81-1238-9-2060)
XX
RN   [2]
RA   Saito M., Kiguchi T., Kusume T., Tamada T.;
RT   "Complete nucleotide sequence of the Japanese isolate S of beet necrotic
RT   yellow vein virus and comparison with European isolates";
RL   Arch. Virol. 141:2163-2175(1996).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4609
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /lab_host="Tetragonia expansa"
FT                   /isolate="S"
FT                   /mol_type="genomic RNA"
FT                   /clone="145-1, H20, S4, S7, pMPCRD5, pMPCRSX19, pMRP70,
FT                   pMSD25"
FT                   /db_xref="taxon:31721"
FT   5'UTR           1. .144
FT   CDS             145. .2217
FT                   /transl_except=(pos:709. .711,aa:OTHER)
FT                   /product="75k protein"
FT                   /note="readthrough product"
FT                   /db_xref="GOA:O11840"
FT                   /db_xref="InterPro:IPR001337"
FT                   /db_xref="UniProtKB/TrEMBL:O11840"
FT                   /protein_id="BAA18968.2"
FT                   /translation="MSSEGRYMTWKDMSHNKFMTDRWARVSDVVSVIKQSHAMDLSKAA
FT                   NLSIIKTALAGLGSGWTDNNPFVSPMTRFPQTLTMYGALVLYVNLSDPEFALIMTKVST
FT                   LTDSGLADNASANVRRDVVSGNKAESSGKTAGTNENSAYTLTVSLAGLAQALRLEELMW
FT                   TRDKFEDRLKLPWTPVQGRTSPPGQXQLAAARVTAHIRAAKRALLYPGDSPEWVGWKHF
FT                   YPPPPYDVYDVPPLDIINAKLAADDIGGLVTPTPASSHGLPFEVSEEVEQANRNSLWLT
FT                   VGLLLAALAVGIGVAAYHRKKLQSRLRELKLLWGSTGGSGGGGGFDTELYMRATDTVSL
FT                   GTTLSEHAASAPSGLRHRPAATDSGPHEALPFEVWVFDNLAVVYDSIGMSDLFYTVREF
FT                   VGVFNGEFEGLIELLESPDDDDGVYTNAPRDTAIDAYESQENYDRIDIETVLIERRINL
FT                   KKLLLEEAELERRERDMTMIADEEQRTLLHRLESSRVEATHAVAKAEADARAAVAMAAL
FT                   ASKEANDYDSKMAFDRSCKEQELRLRELEVNSMPSKTERYVHTGIQGGAQLAGAMAVGA
FT                   MLRRGAGSSSQTVSSGANIGSRSQSLTRGRSASQPLSSVGGSTRGVNNNISNTNLVRAG
FT                   NSAEVSAGRSTNSGNSNFWSKLRVGEGWSKYSVERAATRAQRAIVLPAPPSAPAG"
FT   mat_peptide     145. .708
FT                   /product="coat protein"
FT   mat_peptide     712. .2214
FT                   /product="pot. 54k protein"
FT   CDS             2130. .3284
FT                   /product="42k protein"
FT                   /db_xref="GOA:Q65674"
FT                   /db_xref="InterPro:IPR000606"
FT                   /db_xref="UniProtKB/TrEMBL:Q65674"
FT                   /protein_id="BAA12342.1"
FT                   /translation="MVQVQRRTGGDKGAKGNRASSAPVRSRRMTQDDWSRTHPDDIFSV
FT                   IEKTLVEDGYKWNGVKPGHCDWGKLKESGAIDNFRGTLEGELGKNCDLTCNAAAVKLDT
FT                   LQKVKMSSDWTARVGIVLGAPGVGKSTSIKNLLDKFGAKHKMVLCLPFSQLLEGVFAGR
FT                   LDTFLVDDLFCRSVGYGKYNTMLVDEVTRVHMCEILVLAGHLGVKNVICFGDPAQGLNY
FT                   KAGSAVNYNFPIIAECYASRRFGKATADLINSSNGGGKPVVGNNEVKDSWTFEELCGKI
FT                   LDMSTVLVATRETQKFLLEDNIESILYSDAHGQTYDVVTIILEDEFDDAAICDPNVRAV
FT                   LLTRARKGGMIKMGPNIAARFKNGDFNSRGVSKSCTGDTFCEDR"
FT   CDS             3284. .3640
FT                   /product="13k protein"
FT                   /db_xref="InterPro:IPR001896"
FT                   /db_xref="UniProtKB/TrEMBL:Q65675"
FT                   /protein_id="BAA12343.1"
FT                   /translation="MSREITARPNKNVPIVVGVCVVAFFVLLAFMQQKHKTHSGGDYGV
FT                   PTFSNGGKYRDGTRSADFNSNNHRAYGCGGSGGSVSSRVGQQLVVLAIVSVLIVSLLQR
FT                   LRSPPEHICNGACG"
FT   CDS             3624. .4022
FT                   /product="15k protein"
FT                   /db_xref="InterPro:IPR002223"
FT                   /db_xref="InterPro:IPR010470"
FT                   /db_xref="UniProtKB/TrEMBL:Q65676"
FT                   /protein_id="BAA12344.1"
FT                   /translation="MVLVVKVDLSNIVLYIVAGCVVVSMLYSPFFSNDVKASSYAGAVF
FT                   KGSGCIMDRNSFAQFGSCDIPKHVAESITKVATKEHDADIMVKRGEVTVRVVTLTETLF
FT                   IILSRLFGLAVFLFMICLMSIVWFWCHR"
FT   CDS             4034. .4423
FT                   /product="14k protein"
FT                   /db_xref="InterPro:IPR009884"
FT                   /db_xref="UniProtKB/TrEMBL:Q65677"
FT                   /protein_id="BAA12345.1"
FT                   /translation="MSMGMVDSLCVFVGRVITEGSESVEGVERFSIKFSDWKLFTTAVY
FT                   VEYRQLGEKECSLKDVGRLHFNMSCVKCCQKLKCKKQNKNHSKHVQNGYLRKVRNFSIL
FT                   GVCGDCCESFTLADEKHHVIVDPEV"
XX
SQ   Sequence 4609 BP; 1187 A; 765 C; 1221 G; 1436 T; 0 other;

d84411 Length: 4609  09-JUN-2006  Type: N  Check: 7918  ..
       1  aaattctaac tattatctcc attgaataga atttcaccgt ctgttggttc
      51  ttattttgtt ctgggggcaa ttttattcag ggccctactt taaatatagg
     101  tgcgagtaat aagtagccgc cgtccagaag aagatagtac taacatgtcg
     151  agtgaaggta gatatatgac atggaaggat atgtcacata ataagtttat
     201  gaccgatcga tgggcccgtg tttcggacgt cgtgagtgtt attaaacaat
     251  cgcatgctat ggacttgtcc aaggctgcga atctatctat aattaaaact
     301  gctttggcag gattgggctc gggttggact gacaataatc cttttgtgtc
     351  cccgatgacc cgttttccac agacactaac tatgtacggt gcacttgtgt
     401  tatatgttaa tctgtctgac ccagaatttg cgttgataat gactaaggta
     451  agtactttaa ctgattcagg gttagcagat aacgcatctg ctaatgtgcg
     501  tagagatgtg gtgtccggaa ataaagccga atcatccggt aaaactgctg
     551  gcactaatga gaattctgct tatacgctta ccgttagtct tgctggtttg
     601  gctcaagctc ttaggcttga ggaattaatg tggactcggg ataagtttga
     651  ggaccggttg aaattaccat ggacacctgt tcaaggtaga accagtccac
     701  ccggacaata gcaattagct gctgctcggg tgacggcaca cattcgagcg
     751  gcgaagcggg cactattata tcctggtgat agtcccgagt gggttggttg
     801  gaaacatttc tatcctcctc caccatatga tgtgtacgat gtgccaccgc
     851  tggatattat taacgccaaa ttggctgctg atgatatcgg cggtcttgtt
     901  actcctacac cggcatcctc acatggtctt ccttttgaag tttccgagga
     951  agttgagcag gcaaatagga atagtctatg gctaacagtt ggactgctat
    1001  tagctgcttt ggcagttggg attggtgtag ctgcttatca taggaagaag
    1051  ctccaaagta gattacgtga gttgaagttg ctatggggtt ctactggtgg
    1101  gtctggtggt ggtggtggtt ttgacaccga gctgtatatg cgtgctacag
    1151  atactgttag tttgggaacc actctttcag agcatgctgc ttcagctccg
    1201  tcggggttac ggcaccgacc tgctgctact gatagtggac ctcatgaagc
    1251  gctgccgttc gaggtgtggg tgtttgataa tctagctgta gtgtatgatt
    1301  cgattggtat gagtgattta ttttatactg ttagagagtt tgttggggtg
    1351  ttcaacggtg agtttgaagg gcttatagag ctgttagagt cacccgatga
    1401  tgatgatggt gtgtatacga atgctcctag agacactgcc attgacgcct
    1451  atgaatctca agaaaactac gaccgtattg atattgaaac tgtcttgatc
    1501  gagaggcgta taaacttgaa aaagttgctt cttgaagaag cagagctaga
    1551  acgacgagag cgagatatga ctatgattgc tgatgaagaa caaagaacat
    1601  tgctacatag gttggaaagt tctagggttg aagcaactca tgcagttgcc
    1651  aaagccgaag ctgatgctcg ggcagctgtc gctatggctg ctcttgcttc
    1701  taaggaagct aatgattacg acagtaagat ggcttttgac aggtcttgta
    1751  aagaacagga actgcggttg cgcgaactcg aagtgaatag tatgccgagt
    1801  aaaacagaga ggtatgttca cactggtata caaggtggcg cgcaattggc
    1851  tggagctatg gctgtcggtg ctatgctgcg acgtggggct ggttcttctt
    1901  ctcaaaccgt ttctagtggt gctaatattg gttctcgttc gcagagtttg
    1951  actcgtggtc gtagtgcatc acaacctttg tcatcggttg gtggttctac
    2001  tcgtggggtt aataataata ttagtaatac taatcttgtt agggctggta
    2051  atagtgctga agtttctgct ggtagatcta ctaatagtgg taatagtaat
    2101  ttttggtcca aattacgtgt tggtgaagga tggtccaagt acagcgtaga
    2151  acgggcggcg acaagggcgc aaagggcaat cgtgcttcca gcgcccccgt
    2201  ccgctcccgc cggatgactc aggatgactg gtcacgtacc catcccgacg
    2251  atattttctc agttattgag aaaacactag tagaggatgg gtataaatgg
    2301  aacggggtaa aacccggaca ttgcgattgg ggcaaattga aggaatctgg
    2351  tgctattgat aattttaggg gtacattaga aggcgagtta ggtaaaaatt
    2401  gtgatttgac ttgtaatgct gctgccgtta aacttgacac attgcaaaag
    2451  gtgaaaatgt catcagattg gactgccaga gttggtattg ttttgggtgc
    2501  tcctggtgtt gggaaatcta cctcgattaa gaacttatta gacaaatttg
    2551  gagcaaaaca taaaatggtg ttatgcttac cttttagtca gttgttagaa
    2601  ggagtgtttg ctggtcggtt ggacactttt ctggttgatg atttgttctg
    2651  taggtccgtg ggatatggaa aatacaacac catgcttgta gatgaggtca
    2701  ctcgtgtgca tatgtgtgag attttggtac ttgccggaca tttaggtgtt
    2751  aagaacgtga tatgttttgg tgatccggcg caagggttaa attataaggc
    2801  cggttctgcc gtgaactata attttccgat tattgctgaa tgttatgcta
    2851  gtagacggtt cggtaaggcg actgccgatc tcattaattc cagcaatggt
    2901  ggtggtaaac ctgtagtcgg taataacgag gtaaaggata gttggacttt
    2951  tgaagaacta tgtgggaaga tactagatat gtctactgtt ttggtagcta
    3001  cacgcgaaac ccaaaagttt ctattagaag ataatattga gtctattctt
    3051  tactcggacg cccacgggca aacatacgac gttgtcacta tcattttgga
    3101  agacgagttt gatgatgctg ccatttgcga cccaaatgtt agggctgtct
    3151  tgttaactag agctcgtaag ggtggtatga ttaagatggg tcctaacatt
    3201  gctgccaggt tcaaaaacgg tgattttaat tcacgtggag ttagtaagtc
    3251  ttgcaccgga gatacttttt gcgaagatag ataatgtcta gggaaataac
    3301  cgctcgaccc aataagaatg tgcctattgt tgttggtgtt tgtgttgtgg
    3351  ctttctttgt attgctggcg ttcatgcagc aaaaacataa gacacattct
    3401  gggggcgatt acggagtccc aacattttct aacggtggta aatacagaga
    3451  cggtacaagg tcagctgatt ttaatagtaa taatcatcgt gcttacgggt
    3501  gcggtgggtc tgggggtagc gttagtagtc gagtcgggca gcaacttgtt
    3551  gtgttagcta ttgtgtctgt gttaatagta tcactgttac aacgattaag
    3601  atctccacca gaacatattt gtaatggtgc ttgtggttaa agtagattta
    3651  tctaatattg tgttgtatat agttgccggt tgtgttgttg ttagcatgtt
    3701  gtactcacca tttttcagca acgatgttaa agcgtccagc tatgcgggag
    3751  cagtttttaa agggagtggc tgtatcatgg acaggaattc gtttgctcaa
    3801  tttgggagtt gcgatattcc aaagcatgta gccgagtcca tcactaaggt
    3851  tgctaccaaa gagcacgatg ctgatataat ggtaaaaaga ggtgaagtga
    3901  ccgttcgtgt tgtgactctc accgaaactc ttttcataat attatctaga
    3951  ttgtttggtt tggcggtgtt tttgttcatg atatgtttaa tgtctatagt
    4001  ttggttttgg tgtcatagat aaattgtggt agaatgagta tggggatggt
    4051  agatagtttg tgtgtgtttg ttggtcgggt cataactgag ggatctgaaa
    4101  gtgttgaggg tgtggaacgg ttttccatta agtttagtga ctggaaattg
    4151  ttcaccaccg cggtgtacgt tgaatatcgt cagttaggtg agaaagagtg
    4201  tagtttgaag gatgttggta ggttacattt taatatgtca tgtgtgaaat
    4251  gctgtcaaaa acttaaatgc aagaaacaaa ataaaaatca tagtaaacac
    4301  gtccaaaatg gatatttacg caaggtgcgt aatttttcca ttttaggtgt
    4351  ttgcggtgat tgttgtgagt cttttacact tgcggacgaa aaacatcatg
    4401  ttattgtcga tcctgaggtg taatagggtt tattcaagag actatgttta
    4451  atattaataa tcagggccat gccacaggcc tcctattggg ttgttccgaa
    4501  ggttgttgtg gtttatattg cttattggta agtgatttga ttaaggttgc
    4551  agtgtactga ctgggtgtga attgtaccag tccatgtagg gtctgttttc
    4601  agtatattg