!!NA_SEQUENCE 1.0
ID   BN25KP3    standard; RNA; VRL; 1774 BP.
XX
AC   D84412;
XX
SV   D84412.1
XX
DT   09-MAY-1996 (Rel. 47, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 6)
XX
DE   Beet necrotic yellow vein virus genomic RNA for 25k protein, complete cds.
XX
KW   25k protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1774
RA   Kiguchi T.;
RT   ;
RL   Submitted (12-APR-1996) to the EMBL/GenBank/DDBJ databases.
RL   Tadahiko Kiguchi, Hokkaido Central Agricultural Experiment Station, Plant
RL   Biotechnology; Higashi 6 Kita 15, Naganuma, Hokkaido 069-13, Japan
RL   (Tel:01238-9-2001, Fax:01238-9-2060)
XX
RN   [2]
RP   1-1774
RA   Saito M., Kiguchi T., Kusume T., Tamada T.;
RT   "Complete nucleotide sequence of a Japanese isolate S of beet necrotic
RT   yellow vein virus and comparison with European isolates";
RL   Unpublished.
XX
RN   [3]
RA   Saito M., Kiguchi T., Kusume T., Tamada T.;
RT   "Complete nucleotide sequence of the Japanese isolate S of beet necrotic
RT   yellow vein virus and comparison with European isolates";
RL   Arch. Virol. 141:2163-2175(1996).
XX
DR   SPTREMBL; Q65669; Q65669.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1774
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /clone="pMSC8"
FT                   /isolate="S"
FT                   /lab_host="Tetragonia expansa"
FT   5'UTR           1. .444
FT   CDS             445. .1104
FT                   /db_xref="SPTREMBL:Q65669"
FT                   /product="25k protein"
FT                   /protein_id="BAA12346.1"
FT                   /translation="MGDILGAVYDLGHRPYLARRTVYEDRLILSTHGNVCRAINLLTHD
FT                   NRTTLVYHNNTKRIRFRGLLCAYRVPYCGFRALCRVMLCSLPRLCDIPINGSRDFVADP
FT                   TRLDSSVNELLVSNGLVTHYDRVHNVPIHTDGFEVVDFTTVFRGPGNFLLPNATNFPRS
FT                   TTTDQVYMVCLVNTVNCVLRFESELVVWVHSGLYAGDVLDVDNNVIQAPDGVDDND"
XX
SQ   Sequence 1774 BP; 447 A; 307 C; 374 G; 646 T; 0 other;

  D84412  Length: 1774  July 15, 2003 09:22  Type: N  Check: 2477  ..
       1  aaattcaaaa tttaccatta catattggta tttatttacc ctcagttggt
      51  gatatatgtg aggacgctag cctgttgggt ttcctgaccg accaaatcca
     101  agcgagctta atccaagtac ctcgtctcaa attgagtgtc aagtgaataa
     151  gcatagtgac cccatcgttt cagggtagtt gacggctatt aatagacata
     201  ttacaaacgc ttctctttat ttatcaccaa catgggatgt aatgtttatg
     251  cgtgagctac ggccgcattg taaaattagt ggttttgaat ttctattctt
     301  cggaatatac aaggtttaaa agaccaacat ttgggttaaa aatttttaaa
     351  ccttactatc tttaactagt aactcgaact cgatttatat tcagatttta
     401  aatatcaagt tgttgtgttt tctgatcatc attaagtgac cgtcatgggt
     451  gatatattag gcgcagttta tgatttaggg cacagacctt acctagcacg
     501  gcgtacggtt tatgaggatc gtttgattct tagcacacat ggtaatgtct
     551  gtcgggctat taacttgtta actcacgata atcgtactac actggtgtat
     601  cacaataata ctaaacgcat aaggtttcgt ggattattgt gtgcttatcg
     651  tgtgccttat tgtgggtttc gtgccttatg tagagtaatg ttatgttctc
     701  tacctcgttt gtgtgacatc cctatcaatg gatctcgcga ctttgttgca
     751  gatcctacca gactcgacag ctctgttaat gagttgctgg tttctaatgg
     801  tctcgtcacc cactatgatc gtgttcataa tgttcccata cacactgatg
     851  gttttgaagt tgtagatttt acgactgtct ttcgtggtcc tggaaatttt
     901  cttttgccta atgcaacaaa tttccctcgg tcaaccacaa ccgatcaggt
     951  ttacatggtg tgtttggtaa acacggttaa ttgtgtgtta cgttttgagt
    1001  ccgaacttgt agtgtgggtt cactctggtt tgtatgcagg tgatgtttta
    1051  gatgtggata ataatgttat tcaagcccct gacggtgttg atgataatga
    1101  ttagagttat cacaatttca acaacacact tattggtgtg ttgttctgtt
    1151  acaccatttg aaagtttaat aattgtctca attcgattgt tgatctggtt
    1201  gggacaatta ttttattttc ttttggtgta atcgtccgaa gacgttaaac
    1251  tacacgtgat ttcacggtgt tcggtgagaa gattgtttaa cggtgttacg
    1301  ttgtgtacct ttaagccttc ttctcttttt accacatgtg atgattgtag
    1351  cctgtgggtt gttatgtgga caattatggt tacttatttg taaacgataa
    1401  agagtgtgcg gtagccgact ttatgcgagt gggagtagtt gtgttattac
    1451  tactattctg gttcgtataa agatccttga cggcggcatc gtgggttcca
    1501  cagccggtta catggtgttc ccgtccgttt acgaaggttt aactgtgagc
    1551  cttgtatttt acgaatacac agtttttatc ttaacaggct cgttcacaag
    1601  cctcctttta cattaagttt aaaggtttat gtggacacaa aaatatggct
    1651  tattggttat gctaaacctc atatcatgtt ataatattcg tttcatatta
    1701  taattaaggt taagatgtac tgactgggtg tgaaatgtac cagtccttgt
    1751  agggttcttt gtcagtatat tgac