!!NA_SEQUENCE 1.0
ID   BN31KP4    standard; RNA; VRL; 1465 BP.
XX
AC   D84413;
XX
SV   D84413.1
XX
DT   09-MAY-1996 (Rel. 47, Created)
DT   07-JUL-2003 (Rel. 76, Last updated, Version 6)
XX
DE   Beet necrotic yellow vein virus genomic RNA for 31k protein, complete cds.
XX
KW   31k protein.
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1465
RA   Kiguchi T.;
RT   ;
RL   Submitted (12-APR-1996) to the EMBL/GenBank/DDBJ databases.
RL   Tadahiko Kiguchi, Hokkaido Central Agricultural Experiment Station, Plant
RL   Biotechnology; Higashi 6 Kita 15, Naganuma, Hokkaido 069-13, Japan
RL   (Tel:01238-9-2001, Fax:01238-9-2060)
XX
RN   [2]
RP   1-1465
RA   Saito M., Kiguchi T., Kusume T., Tamada T.;
RT   "Complete nucleotide sequence of a Japanese isolate S of beet necrotic
RT   yellow vein virus and comparison with European isolates";
RL   Unpublished.
XX
RN   [3]
RA   Saito M., Kiguchi T., Kusume T., Tamada T.;
RT   "Complete nucleotide sequence of the Japanese isolate S of beet necrotic
RT   yellow vein virus and comparison with European isolates";
RL   Arch. Virol. 141:2163-2175(1996).
XX
DR   SPTREMBL; Q65670; Q65670.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1465
FT                   /db_xref="taxon:31721"
FT                   /mol_type="genomic RNA"
FT                   /organism="Beet necrotic yellow vein virus"
FT                   /clone="pMSD96"
FT                   /isolate="S"
FT                   /lab_host="Tetragonia expansa"
FT   5'UTR           1. .376
FT   CDS             377. .1225
FT                   /db_xref="SPTREMBL:Q65670"
FT                   /product="31k protein"
FT                   /protein_id="BAA12347.1"
FT                   /translation="MADGEICRCQVTDPPLIRHEDYDCTARMVQKRIEIGPLGVLLNLN
FT                   MLFHMSRVRHIDVYPYLNNIMSISVSLDVPVSSGVGVGRVRVLIFTTSRERVGIFHGWQ
FT                   VVPGCFLNAPCYSGVDVLSDELCEANITNTSVSSVAMFNGSYRPEDVWILLLTSSTCYG
FT                   YHDVVVDIEQCTLPSNIDGCVCCSGVCYFNDNHCFCGRRDSNPFNPPCFQFIKDCNELY
FT                   GTNETKQFICDLVGDDNLDSVNTLTKEGWRRFCDVLWNTTYGDVESRTFARFLWFVFYH
FT                   D"
XX
SQ   Sequence 1465 BP; 367 A; 209 C; 331 G; 558 T; 0 other;

  D84413  Length: 1465  July 15, 2003 09:22  Type: N  Check: 9852  ..
       1  aaattcaaat ctcaaaatat atttgtattt ccagttgatt gtctgtaaaa
      51  caattccagt tgtttatctg taaaataaac atgtatgctt gatcagcttt
     101  gtagatcctt gattaatctt atttctatca ttgaattcga attgtttctg
     151  ttaagattct ctttacgatt tgtgtcgcca tttcgtatat tggaagacgg
     201  gcctgattcc agtattaatt ggtcagttta taggtgcaga acgcttttaa
     251  gtgagaccta cgactgcgtc ggaaccttag attcacgagc cgcgtgatta
     301  attgggtttg tcactgggat ccagtctatc agtaaggggt agtcgtttgt
     351  tgagacttat ctgattagta acatttatgg ctgatggaga gatatgtcgg
     401  tgtcaggtta ctgatcctcc tttgatacgt catgaagact atgattgtac
     451  tgctaggatg gtgcagaaac ggattgagat tggcccattg ggtgtattac
     501  tcaatctaaa tatgttattt catatgtctc gtgttagaca tattgatgtt
     551  tatccgtatc tgaataatat tatgtctatt tcggtgtcgt tggatgttcc
     601  tgtgtctagt ggcgttggtg ttggacgtgt acgtgtttta atatttacaa
     651  ctagtcgtga acgtgttggt atattccatg gatggcaggt tgtgcctggg
     701  tgctttctta atgccccgtg ttatagtggt gttgatgttc tgtctgatga
     751  gttatgtgaa gctaatatta ctaatacctc ggtttcgtct gttgcgatgt
     801  tcaatgggtc gtatagacct gaagacgtct ggatactatt acttacgtct
     851  agtacttgtt atggttatca tgatgttgtt gttgatatag aacaatgtac
     901  attaccttct aatatagatg ggtgtgtttg ttgttctggc gtttgctatt
     951  tcaatgataa tcattgtttt tgtggtcgtc gtgatagtaa tccattcaat
    1001  ccgccttgtt ttcaatttat taaagattgt aatgagttgt atggaacaaa
    1051  tgaaactaaa caattcattt gtgaccttgt tggcgatgat aacttggata
    1101  gtgttaacac tctaacaaaa gaagggtggc gaaggttttg tgatgttctt
    1151  tggaatacca cttatggtga tgttgagtct cgtacttttg cacggtttct
    1201  gtggtttgtc ttttatcacg attagtggta ttgatgatgt gtttagttat
    1251  ttgagataca agactaataa taatatgtat aattgtatta acgggctcgt
    1301  tcacaagcct ccttgctatg gtaaggttta tgtgagcaca aaaatatggc
    1351  ttattggtta tgctaaacct catatcgtat taaatatata taagttaagg
    1401  ttgagatgta ctgactgggt gtgaaatgta ccagtcttta tagggttctc
    1451  tgtcagtata ttgac