!!NA_SEQUENCE 1.0
ID   BMCG       standard; genomic RNA; VRL; 7261 BP.
XX
AC   L49381;
XX
SV   L49381.1
XX
DT   31-MAY-1996 (Rel. 47, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Barley mild mosaic virus RNA1 encoding P3, 6K1, CI, 6K2, NIa, NIb and
DE   capsid proteins.
XX
KW   capsid protein; CI helicase; NIa proteinase; NIb RNA polymerase;
KW   polyprotein.
XX
OS   Barley mild mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Potyviridae;
OC   Bymovirus.
XX
RN   [1]
RX   MEDLINE; 96010210.
RX   PUBMED; 7571407.
RA   Dessens J.T., Meyer M.;
RT   "Characterization of fungally and mechanically transmitted isolates of
RT   barley mild mosaic virus: two strains in competition";
RL   Virology 212(2):383-391(1995).
XX
RN   [2]
RP   1-7261
RX   DOI; 10.1006/viro.1996.0245.
RX   MEDLINE; 96204595.
RX   PUBMED; 8623538.
RA   Meyer M., Dessens J.T.;
RT   "The complete nucleotide sequence of barley mild mosaic virus RNA1 and its
RT   relationship with other members of the Potyviridae";
RL   Virology 219(1):268-273(1996).
XX
CC   Dessens,J.T. and Meyer,M., Characterization of
CC   fungally and mechanically transmitted isolates
CC   of barley mild mosaic virus: two strains in
CC   competition, Virology 212, 383-391 (1995)
CC   refers to bases 6112 to 7262.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7261
FT                   /db_xref="taxon:12466"
FT                   /mol_type="genomic RNA"
FT                   /organism="Barley mild mosaic virus"
FT                   /strain="Reims-M"
FT   5'UTR           1. .147
FT                   /note="putative"
FT   mat_peptide     148. .1023
FT                   /note="putative"
FT                   /product="P3 protein"
FT   CDS             148. .6924
FT                   /codon_start=1
FT                   /db_xref="GOA:Q65654"
FT                   /db_xref="HSSP:1HEI"
FT                   /db_xref="InterPro:IPR001205"
FT                   /db_xref="InterPro:IPR001410"
FT                   /db_xref="InterPro:IPR001592"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001730"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="UniProt/TrEMBL:Q65654"
FT                   /note="putative"
FT                   /product="polyprotein"
FT                   /protein_id="AAC42215.1"
FT                   /translation="MEEFIPEVFYQNQVQSLKKILKSWKRDTSIYAYLAREQEVLAFLV
FT                   LSPAHIAKLNKLLTEESARCALLAQNCETIEALAVVRQALQGVTLHFGDNGMEKGWLHM
FT                   MKALDACLDESFSENAAALKKSIQAVGHKLIAAKNRIESCERSVNHLTTFQFAREYGLS
FT                   TTYFEKLSNFGGHIRSFVWSSDSGEIFPKLKRSSRTRRISTFTSYYWGEFWCNCIWFLC
FT                   CCWSPARWCFNSAVSIWSLCGVLNLSMIVLQFALKRHFGRYYFRYIMSGVLAICAVCCV
FT                   HLKNRKGPILQASQKDKRFIGILAFCITVIYMFDVDLADSLSNNLHKISRLVNLFLDDN
FT                   RGFATPAFDNLTDFTTILQSGTSSDDLKIVQDTLAVVLQVDEEDATQDDAIYDSDGLQT
FT                   FKQWVSHNQLAGMQLARPLQYPCSNTYGLTADNVAELATSMAQEAKQWSQVVGHTGSGK
FT                   STRLPTAYANCLKGLAGRKKNVLVCEPTRAATVNVTSGISQNFGRLVYGRHEGWSNLGD
FT                   KTIQVMTYGSALAAWKVDNKFLSQFDAVFLDESHLITTHALVFESICQEVTNVRKFYVS
FT                   ATPRDGKKCPEAVRRYEIKTVKTECSSVDTFVRSQEKENTLYVLNHDTVLVFLAGKAEC
FT                   DRAASNWNKLYSTNMYAHSLTGDNFTIAYEKIVTRMLTERTIVFCTNILETGVTLNVDC
FT                   VVDFGFTMRPELDLVDKSLTLMRRRVTENERAQRIGRAGRLRTGYAICIGNPETRHDLV
FT                   PPETLYEAALLSFVHGVQFYINEHFENAWIQGVTKSQASVMTQFKLSPFLMRDIVRDDG
FT                   AIPLSLHKILKDYTHRNTDLIGTKLSVMSHIYNSWPLYRTVQQSISRGDSNVPQALRYA
FT                   RVPFNVSTAHDFPWEDFAQACLEFQPRVLQVFSDNSSTSRIINLQIGKMHIINSMEEVK
FT                   INIHSYQRSAEGLRSVKDSFESSIFRTKLLRGNPTGKITKRIETLLDNVRVLQQVHAKL
FT                   EMIAYSGGEKVNMDKKSVDELNEIVELQSKNSLTAEELARILHLTKPTSTFFNLFAERG
FT                   RQMLVTLLVMVAASLMYLVFWVSPRKQDDITIEGKGRAYNRDKRMGYDSYEEDEVRNKI
FT                   NKKFKERSTRFSNDSKPETNSKYRNLKQEFVNFYDLKTDANVLQAVFTAMDGAVLLQTE
FT                   SPMADIGRVNKLLQDHFGDSESRAVHEGLNTMVKCHLTMKDGRQFELDMEQHDPEYVAK
FT                   LGGEVGFRMNRDDLRQVGATRYINPRAQTSAATLEGMTMKPMSSFTIDSAKMVGFIKTA
FT                   KDTLNCILYGDWIIAPAHIQQGEGDITFIFQHIQFTTTTERLASYGIRQFKGLDLVVIR
FT                   RPQQIRAVKKDMRASILDTPTEIQMLYLSVKGGKYQVSTSAVCFPHYNNRWGHVISTAE
FT                   GMCGCIVFDPTTNHIVGIHVSYNDTRRRNEFQAFTSDVLTTINAPGHEIPFSPWVFDWK
FT                   FCGYTTKPRNMQSAPSTLERLNINATGFGFKLNAQEIKPAMLRSTESFSREFPNTQFKL
FT                   IGEVKKGLIDKHTITGENPYFLEFLNTFKPYQWVQAFMDEYAPSILAYDAYFKDLKKYD
FT                   RPPHAKAFCQNTLTKAKNKMINILEEAGMGRTLVRTTEQVLLDMAWTTSGGPLYHGKKI
FT                   DIVQHLSDDELVQFSEACQQALITGTLDGVWNGSLKAELRSSQKILERKTRVFTAAPIT
FT                   SLIAMKYYVDDFNKQFYKTHLKAPHTVGINKFNRGWQNLYEKLNKPGWTHGSGDGSRFD
FT                   SSIDGFLFDVIKDIRKHFMDAEHHKELDTINEEIVNTKICLANGLIIQKNCGNNSGQPS
FT                   TVVDNTLALMTAFLYAYARLTGDHAFELMDENFVFVCNGDDNKFAMSPSFMTKFGCDFS
FT                   PFLSELGLTYEFDEATEDICENPYMSLTMVRTSFGIGFSLSIERIVAILQWSRAGGVLH
FT                   AYLSGIAALFESFNTPKLFNLVHTYLLWLITEHEEELFSMMELKDMFMPLPTKEQIALL
FT                   HYVGTEPIVEDTFLQAGHEEPDPIVPPASDTDLTNMAAAPPDNRRSRAVIPRGTSDWSM
FT                   PEPTMRTLGFKSKIKIETLADVPEGYMNTFASVATESQRRKWEEATRGDFGITDDEKWE
FT                   KLLIAACIYFADNGTSPNFDEELTMEVNSGLNSIKEYPVRPFVVRAKKISTLRRIFRCY
FT                   SIETKLMFVKLRRVPHWAIKHGCLDEIVFDFMIPDQFTSRTALETLKQTKLAAIGVGTS
FT                   NSLLTSEQTNMRTTETRRRNDYDGHEALLR"
FT   mat_peptide     1024. .1224
FT                   /note="putative"
FT                   /product="6K1 protein"
FT   mat_peptide     1225. .3198
FT                   /note="putative"
FT                   /gene="CI"
FT                   /product="helicase"
FT   mat_peptide     3199. .3390
FT                   /note="putative"
FT                   /product="6K2 protein"
FT   mat_peptide     3391. .3927
FT                   /note="putative"
FT                   /gene="NIa"
FT                   /product="viral protein genome-linked"
FT   misc_feature    3568. .3570
FT                   /note="tyrosine residue; putative"
FT                   /gene="NIa"
FT                   /function="covalent binding to viral RNA"
FT   mat_peptide     3928. .4566
FT                   /note="putative"
FT                   /gene="NIa"
FT                   /product="proteinase"
FT   mat_peptide     4567. .6168
FT                   /note="putative"
FT                   /gene="NIb"
FT                   /product="RNA polymerase"
FT   mat_peptide     6169. .6921
FT                   /citation=[1]
FT                   /evidence=EXPERIMENTAL
FT                   /product="capsid protein"
FT   3'UTR           6922. .7261
FT                   /citation=[1]
FT                   /note="putative"
XX
SQ   Sequence 7261 BP; 2066 A; 1888 C; 1601 G; 1706 T; 0 other;

   L49381  Length: 7261  May 10, 2005 10:09  Type: N  Check: 2445  ..
       1  aaaataaaac ttcaatacaa cccaatacaa acaacgaaca acaaacaacg
      51  aatttgcaac ttaccacagc aatatcgacc gctagtaaca gtttaaccaa
     101  actcaacaac aaatcatcct tcgaccaaac gaactctgac catcgagatg
     151  gaggagttca ttcctgaagt gttctaccag aaccaggttc agagtcttaa
     201  gaaaattctc aaatcctgga aacgcgacac ttctatttac gcgtatcttg
     251  ctcgcgagca agaggtccta gccttccttg tactgagtcc cgcacacatt
     301  gccaaattga acaaactact cactgaggag tctgcacgat gtgccctgct
     351  tgcccagaac tgtgaaacca tcgaagctct ggccgttgtt cggcaagccc
     401  tgcagggtgt cacgctacac tttggtgata atggcatgga gaaaggctgg
     451  ttgcatatga tgaaagcact tgatgcatgt cttgacgaaa gcttcagcga
     501  gaacgccgcc gcactcaaga aaagcattca ggcggttggc cacaagctca
     551  tcgcagcaaa aaaccgcatc gaaagctgcg agcgatctgt gaatcacctt
     601  acaacgttcc aatttgctcg cgaatatggc ttaagtacca catacttcga
     651  aaaattatcc aatttcggtg ggcatattcg aagttttgtg tggtccagcg
     701  actcaggaga aattttccca aaacttaaaa gatcatcacg tacgaggcgc
     751  atctcgacat tcacgagcta ctactggggt gagttctggt gcaactgcat
     801  ctggttcctc tgctgctgtt ggtctcccgc gcgctggtgt tttaattctg
     851  cagtttccat atggagtcta tgtggcgttt taaacttatc tatgattgtt
     901  ctacagtttg ctcttaagcg tcattttggt agatactatt ttcgatacat
     951  aatgtctggt gtcctagcta tttgcgccgt gtgttgtgtt catcttaaaa
    1001  acagaaaagg gcctatattg caagcctccc aaaaagataa gcgtttcatc
    1051  ggaattttag ctttctgcat tactgttata tacatgtttg atgttgatct
    1101  agccgactca cttagcaata atcttcacaa gatctctcgc cttgtgaatc
    1151  ttttccttga cgataaccgc ggattcgcaa cacccgcttt cgacaaccta
    1201  acggacttca caacaattct tcaaagtgga acatcaagtg acgacctaaa
    1251  gattgtccag gatacgttgg ctgtggtttt acaagtcgac gaagaggacg
    1301  caactcagga tgacgcaata tatgattccg atggacttca aactttcaag
    1351  caatgggtct ctcacaacca actagccgga atgcagcttg cacgcccgtt
    1401  acaatacccg tgctcgaaca cctatggcct gaccgcagat aacgtcgcag
    1451  aactagcaac tagcatggca caggaggcaa agcagtggtc acaagttgtt
    1501  ggacacactg gttccgggaa gtccacacga ctaccaactg catacgccaa
    1551  ctgtttgaaa ggcttagctg ggcgaaagaa aaacgttctc gtttgtgaac
    1601  ccactagagc tgcaaccgtc aatgtaacca gtggcatttc acagaatttt
    1651  ggtaggcttg tttacggacg gcatgaaggc tggagtaacc ttggcgacaa
    1701  aacaatacaa gtcatgacat atggttctgc actcgcagcg tggaaagtcg
    1751  acaacaaatt cctaagccag tttgacgcag tgtttctcga cgaatctcac
    1801  ctcatcacca cgcacgccct tgtctttgag agcatctgcc aggaggttac
    1851  aaacgtccgc aagttctatg tgtcagccac accccgcgat ggcaagaagt
    1901  gtccagaagc cgtgcgtagg tatgaaatca agactgttaa aaccgagtgc
    1951  agcagcgtcg acactttcgt tcgaagccag gagaaggaaa acacgcttta
    2001  cgttctcaat cacgacaccg tgctcgtttt tctcgctggg aaggctgagt
    2051  gcgatagagc agcaagcaac tggaacaagc tgtactcaac caacatgtac
    2101  gcgcactccc taacaggtga caattttaca atcgcatatg agaaaattgt
    2151  cacacgcatg ctaactgagc gcaccatcgt attctgcaca aatatcctgg
    2201  aaaccggtgt caccctcaac gtggactgcg ttgttgactt tggattcacc
    2251  atgcgtcctg aacttgatct tgttgacaaa tcgctaacct tgatgcgacg
    2301  ccgagtcacc gagaacgagc gtgcacaacg catcgggcgt gcaggaaggc
    2351  ttagaacagg gtacgcaatc tgcatcggca atcccgaaac gcgccacgat
    2401  ctggtgccac cagaaaccct ctacgaggca gcccttctta gcttcgttca
    2451  cggcgtgcaa ttctatatca atgagcactt cgagaacgcc tggattcagg
    2501  gcgtcacaaa gtctcaagcc tctgtgatga cgcagtttaa gctttccccc
    2551  ttcctcatgc gtgacattgt tcgtgatgac ggtgcaatac cactatcact
    2601  ccacaagata ctcaaggact acacgcaccg caacactgat ctgataggaa
    2651  caaaactctc cgtcatgtcg catatctaca actcgtggcc tctctaccgg
    2701  acagtgcaac aatccatttc tcgtggagat tctaatgttc cgcaagcgct
    2751  cagatacgca cgcgttcctt tcaacgtcag cactgcccat gattttccat
    2801  gggaagattt cgcacaggca tgccttgagt tccagccacg tgttcttcag
    2851  gtcttcagtg acaacagcag cacttcgcgc ataatcaacc tacagattgg
    2901  caagatgcac atcatcaatt ccatggaaga agtcaagata aacatacaca
    2951  gctatcagcg ctctgcagaa ggcctacgct cagtcaaaga cagctttgag
    3001  agctcgatct ttcgaacaaa actgcttcgt gggaacccaa ctggaaagat
    3051  aaccaagcgc attgagactc tccttgataa cgtgcgggtg ctacaacagg
    3101  tgcacgcaaa actagagatg attgcatact caggtggaga gaaagttaac
    3151  atggacaaga aatcagttga cgaactcaat gagatcgtcg aactccagag
    3201  caagaattca ctcactgccg aagaactagc acgcatattg caccttacga
    3251  agcccacctc cactttcttc aatctttttg ctgaacgcgg ccgacaaatg
    3301  ctcgtcactc tcctggtcat ggttgccgcc tcgctcatgt atcttgtttt
    3351  ctgggtttcc ccaaggaaac aagacgacat taccattgaa ggaaaaggta
    3401  gagcatacaa tcgtgacaag cgcatggggt acgactccta cgaagaggac
    3451  gaggttcgca acaagatcaa caagaagttc aaagaacgca gcacaaggtt
    3501  ctccaacgat tccaaaccgg aaacaaactc aaaataccgg aatctgaagc
    3551  aagagtttgt taatttctat gatcttaaaa ctgatgcaaa cgtactacaa
    3601  gctgtgttca ctgcaatgga cggagccgtt cttcttcaaa ccgaatcgcc
    3651  aatggcagat attggccgtg tcaataaact gctgcaagac cactttggag
    3701  atagtgagag ccgagccgtg catgaaggtc tcaacaccat ggttaagtgc
    3751  cacttaacta tgaaagatgg aagacagttt gagctcgaca tggaacagca
    3801  tgatcccgag tatgttgcca aacttggagg tgaagttggt ttcagaatga
    3851  acagagatga tctacgccaa gttggcgcca cacggtacat caacccaaga
    3901  gcacaaacat ccgcagcgac gctcgaaggc atgaccatga aacccatgag
    3951  ctctttcacc attgatagcg caaagatggt tggcttcatc aagactgcaa
    4001  aagacacact caactgcatc ctctatggcg actggatcat agctcctgcg
    4051  cacatacaac agggcgaagg ggacataaca ttcatctttc agcacataca
    4101  gttcacgacc acaactgagc gcttagccag ctacggcatc cgacaattta
    4151  aaggccttga ccttgttgtc atccgacgcc cccaacagat acgcgcggtt
    4201  aagaaggaca tgcgtgctag cattcttgac acacctactg agatacagat
    4251  gctatatttg tcagtaaaag gcggcaagta ccaagtgtcc acgtccgctg
    4301  tgtgctttcc acactacaac aaccgatggg gacatgtcat ttcaacggct
    4351  gaaggtatgt gcggttgcat tgtatttgac cccacgacta atcacatcgt
    4401  tggaattcac gtctcctaca acgacacgcg cagaagaaat gagtttcaag
    4451  ctttcacaag tgacgttctg acaacgatta atgcgcctgg acacgaaata
    4501  cctttcagcc cgtgggtctt tgactggaag ttttgcgggt acacgacaaa
    4551  accacggaac atgcaaagcg caccgagcac gcttgagaga ctcaacatca
    4601  acgccacagg tttcggtttc aagctcaacg cacaggagat caaacctgcc
    4651  atgctacgct ccacagagtc gttctccagg gagtttccaa acacacagtt
    4701  caaacttatc ggtgaagtga agaaaggact catcgacaaa cacacgatta
    4751  caggagagaa tccctacttc cttgaattcc tgaacacatt caaaccatat
    4801  caatgggtac aggccttcat ggacgagtac gcaccctcca tccttgccta
    4851  tgatgcgtat ttcaaggact tgaagaaata cgataggcca ccacatgcaa
    4901  aagctttctg ccagaacaca ttaaccaaag ctaaaaacaa gatgatcaac
    4951  attctcgaag aggcaggcat gggaaggacc ctagtacgaa ccaccgagca
    5001  agtcttgctt gacatggcgt ggactacctc tggtggacca ttataccatg
    5051  gtaagaagat tgacattgtg caacacttgt ctgatgacga gcttgtacaa
    5101  ttcagtgaag cctgccaaca ggctctcatc actggaacgc tggatggagt
    5151  ctggaacgga tcactcaaag ccgaactgcg ctcttcgcag aaaatccttg
    5201  aacggaaaac tcgtgttttc actgctgccc ccatcacaag cctaatcgca
    5251  atgaaatatt atgtggatga tttcaacaag cagttctata aaacccacct
    5301  caaagcacca cacacagtcg gcatcaacaa gtttaaccgc ggatggcaga
    5351  atctctatga gaagctcaac aaacctgggt ggacgcatgg gagcggggat
    5401  ggctccaggt tcgatagctc tattgacgga ttcctttttg acgtcatcaa
    5451  agacatccgg aagcatttca tggatgcaga acaccacaag gagctagaca
    5501  caattaatga agagattgtc aacacaaaaa tatgtctagc aaatggtctc
    5551  atcatccaaa agaactgtgg gaacaacagc gggcagccaa gtactgttgt
    5601  agacaacaca cttgcactca tgactgcttt cctctacgca tacgcccggc
    5651  tcactggaga ccacgccttc gaactcatgg acgaaaactt tgttttcgtt
    5701  tgcaatggtg acgacaacaa gttcgctatg tcacctagct tcatgacaaa
    5751  gtttggatgc gacttctcac cattcctttc tgagctaggg ctaacctacg
    5801  aattcgacga agccactgaa gacatttgtg aaaaccccta catgtccttg
    5851  acgatggtcc gcacctcgtt tgggatcggt ttctccctct ccatagagcg
    5901  catcgttgca atcttgcaat ggagccgcgc tggcggagtc ctgcatgcct
    5951  acctctctgg cattgcggct cttttcgaat ccttcaacac acccaagctc
    6001  tttaatctcg tgcacacata cctcctctgg ctcatcacag agcacgagga
    6051  ggaactcttc tctatgatgg aactcaaaga catgttcatg cccctgccca
    6101  ctaaggaaca gatagccttg ttgcactacg tcgggactga gcccatcgtg
    6151  gaggacactt tcctgcaagc agggcatgag gaaccagatc ccatagttcc
    6201  accagcctcc gacaccgatc tgacaaacat ggctgcagca ccaccggaca
    6251  acagaaggtc acgtgccgtc atcccccgtg gcactagtga ttggagcatg
    6301  cccgaaccca caatgcgaac actgggtttt aagtccaaga tcaaaatcga
    6351  aacacttgct gatgtccccg aagggtatat gaataccttt gcgtccgttg
    6401  caactgagtc gcaacgtagg aagtgggaag aggccacgcg tggcgatttt
    6451  ggcatcaccg acgacgagaa atgggaaaaa ttgctcattg ctgcctgtat
    6501  atactttgca gataatggca cctcaccaaa ttttgatgag gaactcacta
    6551  tggaagttaa tagcggtctc aactccatca aagagtatcc cgttcgccct
    6601  ttcgtcgtca gggccaagaa gatctccaca ctgcgcagga tcttccgctg
    6651  ttattccatc gaaacgaaac tgatgttcgt aaagctgagg cgcgtgccgc
    6701  attgggccat aaagcacgga tgccttgatg aaatcgtctt tgatttcatg
    6751  atccccgacc agttcacctc caggactgca ctggaaacac tgaagcagac
    6801  caagcttgcc gccattggtg ttggcacaag caattctctt ctcacctctg
    6851  agcagacgaa catgaggacc actgaaaccc gaaggcgcaa tgactacgat
    6901  ggtcacgagg cgcttctccg gtagatctct catgcagttt catttccttt
    6951  caagcagtgc atttaaatac gcttttaatt acatcaagcg tcaagaattc
    7001  ctcccgcttg cagcaaatcc ttaaagggtg gcactttgtg ttatgcaatg
    7051  gaaaattcag tgacgcaatc aaccatcatt ggttggtgac aacgcagtac
    7101  tttctttctt tcacatcaag cgaccagcac atcgcccgct tacagctaat
    7151  cctacctgag ggtggcactc tgtgttatgt aatggaatgt gctatctcgc
    7201  aaccaaccgt cattggttga tggtgcggct aacacccgcg ctcttgtata
    7251  ccggaaaggt t