!!NA_SEQUENCE 1.0
ID   BNYVVR3A   standard; RNA; VRL; 1775 BP.
XX
AC   M36894;
XX
SV   M36894.1
XX
DT   31-AUG-1990 (Rel. 25, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 4)
XX
DE   Beet necrotic yellow vein mosaic virus F2 RNA-3.
XX
KW   .
XX
OS   Beet necrotic yellow vein virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Benyvirus.
XX
RN   [1]
RP   1-1775
RA   Bouzoubaa S., Guilley H., Jonard G., Richards K., Putz C.;
RT   "nucleotide sequence analysis of rna-3 and rna-4 of beet necrotic yellow
RT   vein virus, isolates f2 and g1";
RL   J. Gen. Virol. 66:1553-1564(1985).
XX
DR   SWISS-PROT; P19229; Y25K_BNYVF.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1775
FT                   /db_xref="taxon:31721"
FT                   /organism="Beet necrotic yellow vein virus"
FT   CDS             447. .1106
FT                   /codon_start=1
FT                   /db_xref="SWISS-PROT:P19229"
FT                   /note="viral ORF"
FT                   /protein_id="AAA42798.1"
FT                   /translation="MGDILGAVYDLGHRPYLARRTVYEDRLILSTNGNICRAINLLTHD
FT                   NRTSLVYHNNTKRIRFRGLLCAYHRPYCGFRALCRVMLCSLPRLCDIPINGSRDFVADP
FT                   TRLDSSVNELLVSTGLVIHYDRVHDVPIHTDGFEVVDFTTVFRGPGNFLLPNATNFPRP
FT                   TTTDQVYMVCLVNTVDCVLRFESELTVWIHSGLYTGDVLDVDNNVIQAPDGVDDDD"
XX
SQ   Sequence 1775 BP; 446 A; 304 C; 375 G; 650 T; 0 other;

M36894  Length: 1775  December 21, 2001 15:55  Type: N  Check: 2063  ..
       1  agaaattcaa aatttaccat tacatattgg tatttattta ccctcagttg
      51  gtgatatatg tgaggacgct agcctgttgg gtttcctgac cgaccaaatc
     101  caagcgagct taatccaagt acctcgtctc aaattgagtg tcaagtgaat
     151  aagcatagtg actccatcgt ttcagggtag ttaacggcta ttaatagaca
     201  tattacgaac gcttctcttt atttatcacc aacatgggat gtaatgttta
     251  tgcgtgagct acggccgcat tgtaaaatta gtggttttga atttctattc
     301  ttcggaatat ccaaggttta aaagaccagc atttgggtta aaaattttta
     351  aaccttacta tctttaacta gtaacttgaa ttcgatttat attcagattt
     401  tgcatatcaa gttgttgtgt tttctgatca tcattaagtg gccgtcatgg
     451  gtgatatatt aggcgcagtt tatgatttag ggcacagacc ttacctagca
     501  cggcgtacgg tttatgagga tcgtttgatt cttagcacaa atggtaatat
     551  ctgtcgagct attaacttgt taactcacga taatcgtact tcactggtgt
     601  atcacaataa cactaaacgc ataaggtttc gtggtttatt gtgtgcttat
     651  cataggcctt attgtgggtt tcgtgcctta tgtagagtaa tgttatgttc
     701  tttacctcgt ttgtgtgaca tccctatcaa tggatctcgc gactttgttg
     751  cggatcctac cagactcgac agctctgtta atgagttgtt ggtttctacc
     801  ggtctcgtca tccactatga tcgtgttcat gatgttccca tacacactga
     851  tggttttgaa gttgtagatt ttacgactgt ctttcgtggt cctggaaatt
     901  ttcttttgcc taatgcaaca aatttccctc ggccgaccac aaccgatcag
     951  gtttacatgg tgtgtttggt aaacacggtt gattgtgtgt tacgttttga
    1001  gtctgaactt acagtgtgga ttcactctgg tttgtataca ggtgatgttt
    1051  tagatgtgga taataatgtt attcaagccc ctgacggtgt tgatgatgat
    1101  gattagagtt atcacaattt caacaacaca cttattggtg tgttgttctg
    1151  ttacaccatt tgaaagttta ataattatct caatccgatt gttgatctgg
    1201  ttgggacaat tattttattt tcttttggtg taatcgtccg aagacgttaa
    1251  actacacgtg atttcacggt gttctatgag aagattgttt aacggtgtca
    1301  cgttgtgcat ttttaagcct tcttctcatt taaccacatg tgatgattgt
    1351  agcctgtggg ttgttatgtg gacaattatg gttacttatt tgtaaatggt
    1401  aaagagtgtg cagtagcgac tttatgcgag tgggagtagt tgtgttatta
    1451  ctactattct ggttcgtata aagatccttg acggcggcat cgtgggttcc
    1501  acagccggtt acatggtgtt cccgtccgtt tacgaaggtt taactgtgag
    1551  ccttgtattt tacgaataca cagtttttat cctaacaggc tcgttcacaa
    1601  gcctcctttt acattaagtt taaaggttta tgtggacaca aaaatatggc
    1651  ttattggtta tgctaaacct catatcatgt tatagtattt gttttatatt
    1701  ataattaagg ttaagatgta ctgactgggt gtgaaatgta ccagtccttg
    1751  tagggttctt tgtcagtata ttgac